KEGG   Lactobacillus crispatus: LCRIS_00407Help
Entry
LCRIS_00407       CDS       T01222                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lcr  Lactobacillus crispatus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LCRIS_00407 (ruvA)
Enzymes [BR:lcr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LCRIS_00407 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397835..398422
Genome map
AA seq 195 aa AA seqDB search
MYEYFEGVITVVTPSYVVVDVGGVGYKVYSPTPFAYTQGQKAKVFIEQVVRDTGITLYGF
QSQDDKGLFLKLLSVSGIGPKSAMAIMAAEDSNSLAEAIEQGEVKYLTRFPGVGKKTASQ
IVLDLKGKLGDYVARLDRPDNGEDVPPALNDALLALIALGYTQKEVDRITPKLEKVAANT
ADQYIKKGLALLLKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatattttgaaggtgtgattactgtggttacaccaagctatgttgtagttgat
gtcgggggcgttggctacaaggtctatagtcctacaccctttgcctatactcaaggccaa
aaagctaaggtctttattgagcaagtggtgcgtgatactggcattactttatatggtttt
caaagtcaagatgataagggcttgttcttaaaactacttagtgttagcgggattggtcct
aagagtgcaatggcaatcatggcagctgaggatagtaattctttggcggaagcgattgaa
caaggtgaagttaagtacctaactcgttttccaggtgtgggtaaaaagacggcttcacaa
attgtgcttgatttgaagggtaaattaggtgattatgttgctcggcttgatcgtccagac
aatggtgaggatgtgccgccagcattaaatgatgcactgcttgctttaattgctttgggt
tatacccaaaaagaagtggatcggatcacgcctaaactggagaaagttgctgcaaatact
gcagatcaatatattaaaaagggcttagcattactgcttaaaaagtag

DBGET integrated database retrieval system