KEGG   Lactobacillus crispatus: LCRIS_00464Help
Entry
LCRIS_00464       CDS       T01222                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LCRIS_00464 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_00464 (adhE)
   00620 Pyruvate metabolism
    LCRIS_00464 (adhE)
   00650 Butanoate metabolism
    LCRIS_00464 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LCRIS_00464 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LCRIS_00464 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LCRIS_00464 (adhE)
   00626 Naphthalene degradation
    LCRIS_00464 (adhE)
Enzymes [BR:lcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LCRIS_00464 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LCRIS_00464 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
457121..459745
Genome map
AA seq 874 aa AA seqDB search
MAKTQQKETLTEDEKKKQIYDMVDNLVKKSHVALDQMANFTQEQVDKICEAVATAGEQNA
YPLAKMAVEETKRGVVEDKTTKNMYASENIWNSLRHEKTVGVIEEDKELGLTKIAEPKGV
IAGVTPVTNPTSTVIFKAMLALKTRNTIIFGFHPQAQKCCVETGKIIRAAAVAAGAPADA
VQWIEEPSLDATTDLMTNPGVQTILATGGPGMVKAAYSSGKPAIGVGPGNGPSYIEKTAN
IDRAVYDIVLSKNFDNGMVCASENSVVVDTEIYDKVKEEFKKWNCYFLNKGEIKKFEEHF
IDPRRGTVAGPVAGKSAYEIAKLCGVDVPKTTKVIIAEYKGVGRNFPLSAEKLSPVFTLY
RAKNHDDAFKICTDLLNYGGRGHTAGLHSNDKKIIDEFAMKMDACRILVNSPAALGGIGD
LYNNMLPSLTLGTGSYGANTFSHNIGAKDLLNIKTVARRRDNMQWVKVPSKTYFEHNAAN
YLRHMPNVNRFFIVTDEGVADQGFADEITDIISKRLGQKEYEVFKAVTLDPNTDVIKDGV
HRMNIFKPDVVIAIGGGSVMDAAKAMRLFYENPEMSFEEAYQKFLDIRKRVVRFPKINGV
QLVCIPTTSGTGSEVSPIAIISDAKTGIKHTLCDYALTPDVSIVDDQFVQTLPKRLIAWS
GFEALGHAIESYVSTMATDFTRGWSLEAIKTIFANLKKSYDGDLDARKRMHDAATLAGMA
YSNAFLGLEHSIAHTVGSTFDIPSGVSDAIALPQVICFNAKRPEKLAMWPHYSVYRADKD
YAEIARAIGLTGSSDAELIEKLVQKIIDLAESVGIKMAFKDYGVDKAEFDKKVDQLAVEA
YGDQNTVTNPSAPLISQIAQLMRDCYEGKGIKNK
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacacaacaaaaagagactcttacagaggacgaaaagaaaaagcaaatctac
gacatggtcgataacttagtaaagaaatcacatgtcgctttagatcaaatggctaacttc
acacaagaacaagttgataagatctgtgaagcagttgctactgcaggtgaacaaaatgct
tacccactagctaaaatggctgttgaagaaactaaacgtggtgtagttgaagataaaact
accaagaatatgtatgcttcagaaaatatctggaacagtttgcgtcacgaaaagaccgtc
ggcgtaattgaagaagacaaggaattaggtttgactaagattgctgaacctaaaggtgtt
attgcaggtgttactccagtaactaacccaacttcaactgttattttcaaggcaatgctt
gctttgaagacgagaaataccattatctttggtttccacccacaggctcaaaaatgttgt
gtagaaactggtaaaatcattcgtgcggctgctgttgctgcaggtgctcctgcggatgcc
gttcaatggattgaagaaccaagccttgatgcaacgaccgatttgatgactaacccaggt
gttcaaactattttggcaactggtggtccaggtatggttaaagctgcttattcatcaggc
aagccagctattggtgttggtcctggtaatggtccttcttacattgaaaagactgctaat
attgaccgtgcagtttatgacattgttttatcaaagaactttgataacggtatggtttgt
gcttctgaaaattcagttgtcgttgatactgaaatttatgacaaagttaaagaagaattt
aagaagtggaactgctacttcttaaacaaaggagaaattaagaagtttgaggaacacttt
attgatcctcgtcgtggtacggttgctggtccagtagctggtaagtcagcttatgaaatt
gccaagctttgtggtgtggatgtgccaaagacgactaaagtaattatcgctgaatataaa
ggcgtaggtagaaacttcccactttcagcagaaaaactttcaccagtctttactttatac
cgtgctaagaatcacgatgatgcatttaagatttgtactgacttgttaaactatggtggt
cgtggtcataccgctggtcttcactcaaatgataaaaagatcattgatgagtttgccatg
aagatggatgcttgtcgtatcttagttaactcaccagctgcccttggtggtattggtgat
ctttacaacaacatgttgccatcacttactttgggtactggttcttacggtgccaacaca
ttctcacacaacattggtgctaaggacttgttaaacatcaaaacagtggctagacgccgt
gataacatgcaatgggtaaaggtcccatcaaagacttacttcgaacataacgctgctaac
taccttcgtcatatgccaaacgttaaccgtttcttcatcgtaactgatgaaggtgtagct
gaccaagggtttgctgatgaaattactgatatcatttctaagcgtttaggtcaaaaagaa
tatgaagtctttaaggctgtaactcttgatcctaatactgatgtgatcaaggatggtgtt
cacagaatgaacatcttcaagccagacgttgtaattgctatcggtggtggttcagtaatg
gacgctgctaaagcaatgcgcttattctacgaaaacccagaaatgagctttgaagaggct
taccaaaaattcttagacattagaaaaagagtagtccgtttcccaaagattaatggtgta
caacttgtatgtatcccaactacttcaggaactggctcagaagtttccccaattgctatt
atttctgatgctaagactggtattaagcatactttatgtgattatgcattgacgccggac
gtttcaatcgttgatgatcaatttgttcaaactttgcccaaacgtttaattgcttggtca
ggttttgaagcattaggtcacgctatcgaaagctatgtttcgactatggctacagacttt
acccgcggttggtcacttgaagctattaaaacaatctttgctaacttaaagaagtcttat
gacggtgatcttgacgcacgtaagagaatgcatgatgctgcaactttggcagggatggct
tactcaaatgccttccttggtttggaacactcaattgctcacactgttggttcaaccttt
gatattccaagtggtgtcagcgatgcaattgcattgccacaagttatttgctttaatgct
aagcgcccagaaaagcttgctatgtggcctcattactcagtttaccgtgctgataaggac
tatgctgaaattgctagagcaatcggcttaactggttcaagtgatgctgaattaattgaa
aaattagttcagaagattattgatttggctgaatcagttggtattaagatggccttcaag
gattatggcgttgataaggctgagtttgacaagaaggtggaccaattagctgttgaagct
tatggcgaccaaaatactgttactaacccatcagctccattaattagtcaaattgctcaa
ttgatgagagactgctatgaaggtaagggtatcaaaaacaagtaa

DBGET integrated database retrieval system