KEGG   Lactobacillus crispatus: LCRIS_00503Help
Entry
LCRIS_00503       CDS       T01222                                 

Gene name
gtfA1
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lcr  Lactobacillus crispatus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LCRIS_00503 (gtfA1)
Enzymes [BR:lcr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LCRIS_00503 (gtfA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
499932..501374
Genome map
AA seq 480 aa AA seqDB search
MKLQNKAMLITYADSLGHNLKDLSQVMERYFNKAIGGIHLLPIFPSNGDRGFSPTRYDVV
DPKFGSWEDVEKLGQQYYLMFDFMINHLSKHSDYFQDFQAKHEESKYHDLFLSWDKFWPA
GRPTQKDIDLIYKRKDKAPYQEIHFKDGSQEKMWNTFGPDQMDLDVRTKTTQEFIKQNLQ
NLAKHGASLIRLDAFAYAIKKLDTNDFFVEPEIWSLLEEVNDYLKDTPATILPEIHEHYT
MPFKVAKHGYFIYDFALPMVLLYSLYSGNSTQLANWLKKCPMKQFTTLDTHDGLGVVDAK
DVLTDDQIDYTTNKLYKIGANVKKKYSSAEYHNLDIYQINTTYYSALGNDDKKYFLARLL
QIFAPGIPQIYYVGLLAGENDIQLLEKTKEGRDINRHYYELDEIEEQVQRPVVKSLIKLL
EFRNSVPAFDLDGSIKVETPSEHEIVITRMNKAKTDVASAKVDFQNLTYQVKYNDQVFGF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaaaataaagcaatgttgataacttatgcagatagtttaggtcataattta
aaagatttgtcacaagtaatggaacgctactttaataaagctattggtggcattcactta
ttgccaattttcccatcaaatggtgaccgtggcttttcgccaacacgatatgatgtggtt
gatcctaaatttggctcttgggaagacgttgaaaaattaggtcagcaatattatttgatg
tttgattttatgatcaatcatctatctaaacattcagattatttccaagattttcaagct
aaacatgaagaaagcaagtaccatgatctgttcttaagttgggataaattctggccagct
ggtcgtcctacgcaaaaagatattgatctgatttataagcgcaaggataaggctccatat
caagagattcattttaaggatggtagtcaagaaaagatgtggaatacttttggcccagat
caaatggacttggatgttagaaccaaaactacgcaggagtttatcaagcaaaatttacaa
aatttggctaaacatggagcaagtttaattcgcttagatgcctttgcttatgcaattaaa
aagctggacactaatgatttctttgtggaaccagaaatttggtctttgcttgaagaagta
aatgattacttgaaagatacaccagcaacgattttgcctgaaattcatgagcattacact
atgccatttaaggtagctaaacatggttacttcatttatgattttgctttgccaatggtg
ttgctgtattcactctatagtggaaatagtacgcaactagctaactggctaaagaaatgc
ccaatgaaacaatttactacattagatacgcatgatggattgggggtggttgacgcaaaa
gacgttttaactgatgatcaaatcgattacacaactaataagctttacaagataggtgct
aatgttaagaagaagtattcgagtgctgaataccataatttggatatctatcaaattaat
acgacatattattcagcattgggtaatgatgataagaaatacttccttgcacgtttgttg
caaattttcgcaccaggtattcctcaaatttattatgttggtttgcttgccggtgaaaat
gatattcaattattggaaaagactaaggaaggtcgagatattaaccgtcactattacgaa
ttagatgaaattgaagagcaagttcaaagaccagtggttaagtcattgattaaactgttg
gaatttcgtaattctgttcctgcctttgatttggatggatcaataaaggtagagacgcca
agtgagcatgaaattgtcattactagaatgaataaagctaagactgacgtggctagtgct
aaggttgatttccagaatttgacttatcaagttaaatataatgatcaagtatttggtttt
taa

DBGET integrated database retrieval system