KEGG   Lactobacillus crispatus: LCRIS_00629Help
Entry
LCRIS_00629       CDS       T01222                                 

Gene name
galU
Definition
utp-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lcr  Lactobacillus crispatus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LCRIS_00629 (galU)
   00052 Galactose metabolism
    LCRIS_00629 (galU)
   00500 Starch and sucrose metabolism
    LCRIS_00629 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LCRIS_00629 (galU)
Enzymes [BR:lcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LCRIS_00629 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632496..633398
Genome map
AA seq 300 aa AA seqDB search
MKVRKAVIPSAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKKSGIEDILIVIGKNK
RPIEDHFDSNPELEQDLEEKGKKELLRLTEGITDLGVNLYYTRQPHPAGLGDAIFRARSF
VGDEPFVVMLGDDLMEDKVPLTKQLIDRYNKTHASTIAVMPVPHEEVSKYGVIEPENEIM
PGLINVKSFVEKPDIDKAPSDYAIIGRYLLTPEIFDILANQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFKGERHDVGNKEGYLETSIEYGLKHPEIKEQLRAYIMQLSKKFEAEGKQNKK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagccgttatcccatcagctggtttgggtactagatttttacctgca
actaaggctttacctaaggaaatgttacctatcgttgataaaccaacaattcagtttatc
gttgaagaggctaaaaagtcaggaatcgaagatattttaattgtaattggcaagaacaaa
cgcccaattgaagatcactttgattctaatccagaactagaacaagatttggaagaaaag
ggtaaaaaagaattgcttcgcctaaccgaaggaattactgatttaggcgttaacttgtat
tacactcgtcaaccgcatccagcaggtttaggagacgccatcttccgtgctcgcagtttt
gttggggatgaaccatttgtagttatgttgggcgacgacttaatggaagataaggtgcca
ttgaccaagcaattgatcgatcgctataacaagacgcatgcttctacaattgcagttatg
cctgtgccacatgaagaagtttctaagtatggtgtcatcgaaccggaaaatgagatcatg
ccaggactgatcaatgttaagtcattcgttgaaaagcctgatattgataaagcacctagt
gattatgccattattggtcgttacttattaacacctgaaatttttgatattttggctaac
caaaaaccaggtcgtggcggtgaaattcaattgactgatgcgattgatacaatgaacaag
actcaacgtgtctttgctcatgtctttaaaggcgaacgtcatgatgttggtaacaaagaa
ggctaccttgaaacttcaattgaatatggtttgaagcacccagaaattaaggaacaattg
cgggcatatatcatgcaattgagcaagaagtttgaagccgaaggtaagcaaaataaaaaa
taa

DBGET integrated database retrieval system