KEGG   Lactobacillus crispatus: LCRIS_00709Help
Entry
LCRIS_00709       CDS       T01222                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lcr  Lactobacillus crispatus
Pathway
lcr00010  Glycolysis / Gluconeogenesis
lcr00051  Fructose and mannose metabolism
lcr01100  Metabolic pathways
lcr01110  Biosynthesis of secondary metabolites
lcr01120  Microbial metabolism in diverse environments
lcr01130  Biosynthesis of antibiotics
lcr01200  Carbon metabolism
lcr01230  Biosynthesis of amino acids
Module
lcr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_00709 (tpiA)
   00051 Fructose and mannose metabolism
    LCRIS_00709 (tpiA)
   00562 Inositol phosphate metabolism
    LCRIS_00709 (tpiA)
Enzymes [BR:lcr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LCRIS_00709 (tpiA)
Exosome [BR:lcr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LCRIS_00709 (tpiA)
  Exosomal proteins of bladder cancer cells
   LCRIS_00709 (tpiA)
  Exosomal proteins of melanoma cells
   LCRIS_00709 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF5105 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CBL50156
UniProt: D5H2C1
Position
715242..716000
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLHMNPEQTTEFVNAVKDKLPDPSKVESLICAPAVDLDALRKAAEGSNL
HIGAENCYFEDEGAYTGETSPKVLKEMGMDYVIIGHSERRGYFHETDEDINKKAKAIFAN
GLKPIICCGESLETREANKQEDWVVAQIKAALDGLTAEQVSSLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMAKPDIDGGLVGGASLV
PESFLELVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtacaccaattattgctggtaactggaagttacatatgaatccagaacaaact
actgaattcgttaacgctgttaaggataagttaccagacccaagtaaggttgaatcactt
atttgtgcacctgcagttgaccttgacgctttgagaaaagctgctgaaggctcaaactta
catatcggtgcagaaaactgttactttgaagacgaaggtgcttacactggtgaaacttca
cctaaggtcttgaaagaaatgggtatggactacgtaattattggtcactcagaacgtcgt
ggttacttccacgaaactgacgaagacattaacaagaaggctaaggcaatctttgctaat
ggcttgaagccaatcatttgctgtggtgaatcacttgaaacgcgtgaagctaacaagcaa
gaagactgggtagttgctcaaattaaggctgctttagacggcttaactgctgaacaagta
tcttcacttgttattgcctacgaaccaatctgggctatcggtactggtaagactgcttca
tcagatcaagctgaagaaatgtgcaagactattcgtgaaactgttaaggacttgtacaac
gaagaaactgcagaaaacgttcgtattcaatacggtggttctgtaaaaccagctaacgtt
aaggaattaatggctaagcctgatattgacggtggcttggttggtggtgcttcattagta
ccagaatcattcttagaattggtaaactaccaagactaa

DBGET integrated database retrieval system