KEGG   Lactobacillus crispatus: LCRIS_00731Help
Entry
LCRIS_00731       CDS       T01222                                 

Gene name
bglA1
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lcr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735741..737216
Genome map
AA seq 491 aa AA seqDB search
MSFPKNFLWGGATAANQIEGAYDEDGKGLSVTDITTAGSLDAPRMLTYKLNGKLEKTPGV
PGAGLPEGAVGAIDPNEYYPNHVAIDFYHHYKDDIKMFADMGFKTFRLSIAWTRIFPKGD
EEKPNQAGLDFYRRVFEECKKYDIEPLVTISHYEDPLYLSEKYHDWGDREMIDMYVKYAK
TLFEEYKGLVKYWLTFNEINSTLLMLSAFGNNVTDDKVYQHAYQKLHYQFVASARAVKLA
HEIDPDYVVGNMICGIVDYPLTPDPKDILANRHMWEQNIFYCGDAQCKGKYPTFAKRLWK
EHNVHLDITEQDKKDMLEGKVDMYTFSYYMSNVITTHEVKDKVGGNFAAGAKNPYLKYSE
WGWATDPDGLQYYLEVMYDRYEIPMMVVENGLGAVDKISDDGKIHDDYRIDYLRMHIKAM
NRAIEDGVDVRAYTTWGCIDEVSAGTGQMSKRYGFIYVDRDDEGKGTLDRMPKDSYYWYK
KVIASNGADLD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttccaaagaactttttatggggcggagcaactgccgctaaccaaatcgaaggt
gcatatgatgaagatggtaaaggcctatcagtaacagatattactactgcaggtagctta
gatgcacctagaatgttgacttacaagttaaatggtaagttagaaaaaacaccaggagtt
ccaggtgcgggacttcctgaaggggcagttggtgcaattgatcctaatgaatattatcct
aaccatgtagcgattgatttttatcaccattacaaagatgatattaagatgtttgcggac
atgggtttcaaaaccttccgtttatcaattgcttggactcggatcttccctaagggtgat
gaggaaaagccaaatcaagctggacttgatttctatcgtagagtatttgaagaatgtaaa
aaatatgatattgaacctttagttacgatttctcactatgaagatccactttacctcagt
gaaaaataccacgactggggcgaccgtgaaatgatcgatatgtatgttaaatatgctaaa
actttgtttgaagaatacaaggggttagtaaagtactggttaacctttaacgaaatcaac
tcaactttactgatgctcagtgcctttggtaacaatgtgactgatgataaagtttaccaa
catgcatatcaaaaattgcattatcaatttgtagccagtgctcgtgcagttaagttggct
catgaaattgatcctgattatgtggtagggaatatgatttgtgggatcgttgattaccca
ttaaccccagatccaaaggatattttggctaaccgccatatgtgggaacaaaatattttc
tactgtggggatgcacaatgcaagggtaagtatccaacatttgctaagcgtctttggaaa
gaacacaatgttcacttagacattactgagcaagataagaaggatatgttggaaggtaaa
gttgatatgtacaccttttcttactacatgagcaacgttatcacaactcatgaagtaaaa
gataaggttggcggtaacttcgccgctggtgctaagaatccataccttaagtattcagaa
tggggttgggcaactgatccagatggcttgcaatactaccttgaagttatgtatgaccgt
tacgaaatcccaatgatggtagttgaaaatggtctaggtgccgttgataagattagtgat
gatggtaagattcatgacgattaccgcattgattaccttagaatgcacattaaggcaatg
aatcgtgcgatcgaagatggcgttgatgtccgtgcctacactacttggggctgtattgat
gaagtatcagctggtaccggtcaaatgtctaagcgttacggttttatctatgttgatcgt
gatgatgaaggtaaaggtactttagatagaatgccaaaggattcttactactggtacaag
aaagttattgcttcaaatggtgcagatttagattaa

DBGET integrated database retrieval system