KEGG   Lactobacillus crispatus: LCRIS_00845Help
Entry
LCRIS_00845       CDS       T01222                                 

Gene name
recD
Definition
exodeoxyribonuclease v alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lcr  Lactobacillus crispatus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LCRIS_00845 (recD)
Enzymes [BR:lcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LCRIS_00845 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
845600..847969
Genome map
AA seq 789 aa AA seqDB search
MNEFTGKVNGIVFENSKDLYKILDVEIIGTLSDYSRPDIKVTGNFGDIQINSSYRFEGKL
VMHEKFGLQFRANNYKQVLPHEEGSLTKYLSSNKFPGIGKKAATTIIDELGLNALDVLKE
SPAKIDKLSLTRKQKDSLLAGLNAMDSYSEVILKLAKYGINKRIAGRVYQLYHGEALAKL
EKDPYAAVNDISGFAFKTADMMGSQLDIASDDPRRIKGAVYQVLLDALNGEGDTYVGLAE
LLTEASKLLQINQFDPIASCINSLQEAGKVIVDGENAALQNIYQTEVDIARLMKNLVEKK
EDKKREQYDDKKVEQAIKDAEKELKIHYDDTQKLAIKNAVNQPISILTGGPGTGKTTIIN
GILLVLRKLAEIPSSALYSEDPPFLLAAPTGRAAKRMGEITGISAKTIHRMLGLGIGDTN
TQDLNELNGEILIVDEMSMVDMFLFKQLLASIHDTRHIVFVGDKDQLPSVGAGNVFSDLI
KSQAFPTTILKQIHRQGDDSTIITLAHDVNEGKDQQALFKKTKNYSFISCRPELVGDAVG
QIVKLALKRGFAKDDIQVLSAMYLGNGGVTNLNNVIQAILNPSQPKSKVLEAHNEVFRIG
DRILQLQNNPEKDIYNGQIGKIISIDEDDANECMIADFDGREVAFSRKDLNDLTRAYAIT
IHKSQGSEFPLVILNLTMQNFVMLKRNLLYTAITRAEKNLVLVGDPRAFVAAFKTPGNDR
KTGLAAKICQQLGITKSLDKSDQSKQHEKAQEMENETDKAEVAEDFVLTPEKIYSGEIDP
MIGMENIKL
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatttaccggtaaggttaacgggattgtttttgaaaatagtaaagacttgtat
aaaattcttgacgttgaaattatcggcactttatccgattattctcgtcccgatattaag
gtgacagggaattttggcgatattcaaattaatagtagctatcgcttcgagggtaaacta
gtaatgcatgaaaaatttggcttgcagtttagagcaaataactataagcaagtcttgcca
catgaagagggatctttaactaagtatttgagttcgaataagttccctggaattggtaaa
aaggctgcgactacgattattgatgaattagggctaaatgccttagatgtattgaaggaa
agtccagctaagattgataagctttctttaactagaaagcaaaaggatagtcttttggca
ggactaaatgcgatggattcttattcagaagtaattttaaaattggctaaatacggcatt
aataagcgtattgcaggacgggtttaccagctttatcatggtgaagcattagcaaaacta
gagaaagatccttatgcagcagttaatgatatttcgggttttgcatttaaaaccgcggat
atgatgggaagccaattagatattgctagtgatgatccacgtagaattaaaggtgctgtt
tatcaagtattactcgatgctttaaatggtgagggagatacttatgtaggcttagctgag
ttattaacagaagcaagtaaattgcttcaaatcaatcaattcgacccaattgctagctgt
attaatagtttacaagaagctggcaaagtaatagttgatggtgagaatgctgctctacaa
aatatttatcaaacagaagttgatattgctcgcttgatgaaaaacttggtagaaaaaaaa
gaagataaaaaaagagaacaatatgatgataaaaaggtagagcaagcaatcaaggatgct
gaaaaggaacttaagattcactacgacgatacacagaagttggccatcaaaaacgcagtt
aaccaaccgatttctattttgacaggtggaccaggtacaggtaaaactactatcattaat
ggaattttattagtattacgcaagctggctgagattccttcctccgctctttacagtgaa
gatcctccgtttttactagcagcaccgactggacgtgcagctaaaagaatgggtgaaatt
accggaatcagtgctaaaacaattcaccgaatgttggggttaggtattggtgatactaac
actcaggacttgaatgagttaaatggtgaaatcttaattgttgatgaaatgtcgatggtt
gacatgttcctttttaaacaacttttggcaagtattcatgatacgcggcatattgttttc
gtcggtgataaggatcagttaccttcggttggagctggcaatgtcttcagtgacctgatt
aaatcgcaagcgtttccaactactattttgaagcagattcatagacagggtgatgattca
acgattattactttggcgcatgatgttaatgagggtaaagatcagcaagcattgtttaag
aaaacaaagaattattcttttattagctgtcgtcccgaattagtaggggatgcagttgga
caaattgttaaacttgctttaaaacgtggatttgcaaaagatgatattcaagtgcttagc
gcgatgtatcttggcaatggtggtgtaactaaccttaataatgttattcaggcaatttta
aacccatctcagcctaaaagtaaggtattagaagcacataatgaagttttccgaattggc
gatcgtattctgcaattgcaaaataatcctgaaaaagatatttataatggacaaattggt
aagatcattagcattgatgaagatgatgccaatgaatgcatgattgcagattttgatgga
agagaagttgccttttctagaaaagatttaaatgatctgacccgggcttatgcaatcact
attcataaatcacaaggttcagaatttccattggtaatcttgaatctaaccatgcagaat
tttgtgatgctaaaacgaaaccttttgtatactgcaataacgcgagctgagaaaaactta
gtgttagttggtgatccacgggcatttgtggcagcttttaagacaccgggaaatgatcgt
aagactggcttagcagcgaagatttgtcagcaattgggtattacaaaatcattggataaa
tctgatcaaagcaagcagcacgaaaaagctcaagaaatggagaatgaaaccgataaagca
gaagtagcagaagattttgttctaaccccggaaaaaatatattctggtgaaattgatcca
atgattggaatggaaaatatcaaattataa

DBGET integrated database retrieval system