KEGG   Lactobacillus crispatus: LCRIS_00900Help
Entry
LCRIS_00900       CDS       T01222                                 

Gene name
glk
Definition
sugar kinase, rok family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCRIS_00900 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_00900 (glk)
   00052 Galactose metabolism
    LCRIS_00900 (glk)
   00500 Starch and sucrose metabolism
    LCRIS_00900 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LCRIS_00900 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LCRIS_00900 (glk)
   00524 Butirosin and neomycin biosynthesis
    LCRIS_00900 (glk)
Enzymes [BR:lcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LCRIS_00900 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(900554..901414)
Genome map
AA seq 286 aa AA seqDB search
MDLAAIDIGGTTIKIATWKDGKLQDKHAVNTPKDLNIFYDILTAEVNKIKQNTKIKGVAI
SSPGAVDQKNGIIGGSSALPYIHNFKIVDELKKRFELPVSIENDANSAALGELAEGAGKG
SDSMAFFVIGTGIGGAIIINQKVWHGAHLFGGEFGYMSIGTKSVSDLASPVAMANRYNER
TGKKLDGKTVFALADEDDPVASDERQTLIHSLALAIYNVQQSFDPDKIVIGGGISNNPEL
IPLLNREIDYIRKQVNPASIKPEIVLCSLKSNANLRGAVADFEQAH
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggatttagcagcaattgatattggcggtacaacaatcaaaatcgcaacttggaaagac
ggtaaattacaggataaacatgccgttaatacgccaaaggatttaaatattttttacgat
attttgactgcagaagttaataaaattaaacaaaataccaaaataaaaggtgtggcaatc
tcttcaccaggtgcagttgaccaaaaaaatggcattattggtggttcttctgcccttcca
tacatccataactttaaaatcgttgacgaattaaaaaagcgttttgaattacctgtttct
atagaaaatgatgccaactccgctgcgttaggcgaattagcagaaggtgctggcaaaggt
agtgacagcatggctttctttgttattggtacaggtattggtggtgccatcattattaat
caaaaagtctggcatggcgctcacctatttggtggtgaattcggttacatgagcattggt
acaaaatctgttagtgatctggcatccccagtggcaatggctaaccgctataacgaaaga
actggtaaaaaacttgatggtaaaacagtcttcgctttagcagacgaagatgatccagta
gccagcgatgagcgtcaaaccttaattcattccctagccttagcaatttacaacgttcag
caaagttttgaccctgacaaaattgtaattggcggtggcatttctaataatccagaatta
attccgttattgaatcgcgaaattgactatattcgcaaacaagtcaatccagcaagtatt
aaacctgaaattgtgctttgcagtttgaagagtaatgcaaacttacgtggcgcagttgca
gattttgaacaagcacattaa

DBGET integrated database retrieval system