KEGG   Lactobacillus crispatus: LCRIS_00900Help
Entry
LCRIS_00900       CDS       T01222                                 

Gene name
glk
Definition
(GenBank) Sugar kinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lcr  Lactobacillus crispatus
Pathway
lcr00010  Glycolysis / Gluconeogenesis
lcr00052  Galactose metabolism
lcr00500  Starch and sucrose metabolism
lcr00520  Amino sugar and nucleotide sugar metabolism
lcr00521  Streptomycin biosynthesis
lcr01100  Metabolic pathways
lcr01110  Biosynthesis of secondary metabolites
lcr01120  Microbial metabolism in diverse environments
lcr01130  Biosynthesis of antibiotics
lcr01200  Carbon metabolism
Module
lcr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_00900 (glk)
   00052 Galactose metabolism
    LCRIS_00900 (glk)
   00500 Starch and sucrose metabolism
    LCRIS_00900 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LCRIS_00900 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LCRIS_00900 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LCRIS_00900 (glk)
Enzymes [BR:lcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LCRIS_00900 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FtsA Glucokinase
Motif
Other DBs
NCBI-ProteinID: CBL50347
UniProt: D5H2W2
Position
complement(900554..901414)
Genome map
AA seq 286 aa AA seqDB search
MDLAAIDIGGTTIKIATWKDGKLQDKHAVNTPKDLNIFYDILTAEVNKIKQNTKIKGVAI
SSPGAVDQKNGIIGGSSALPYIHNFKIVDELKKRFELPVSIENDANSAALGELAEGAGKG
SDSMAFFVIGTGIGGAIIINQKVWHGAHLFGGEFGYMSIGTKSVSDLASPVAMANRYNER
TGKKLDGKTVFALADEDDPVASDERQTLIHSLALAIYNVQQSFDPDKIVIGGGISNNPEL
IPLLNREIDYIRKQVNPASIKPEIVLCSLKSNANLRGAVADFEQAH
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggatttagcagcaattgatattggcggtacaacaatcaaaatcgcaacttggaaagac
ggtaaattacaggataaacatgccgttaatacgccaaaggatttaaatattttttacgat
attttgactgcagaagttaataaaattaaacaaaataccaaaataaaaggtgtggcaatc
tcttcaccaggtgcagttgaccaaaaaaatggcattattggtggttcttctgcccttcca
tacatccataactttaaaatcgttgacgaattaaaaaagcgttttgaattacctgtttct
atagaaaatgatgccaactccgctgcgttaggcgaattagcagaaggtgctggcaaaggt
agtgacagcatggctttctttgttattggtacaggtattggtggtgccatcattattaat
caaaaagtctggcatggcgctcacctatttggtggtgaattcggttacatgagcattggt
acaaaatctgttagtgatctggcatccccagtggcaatggctaaccgctataacgaaaga
actggtaaaaaacttgatggtaaaacagtcttcgctttagcagacgaagatgatccagta
gccagcgatgagcgtcaaaccttaattcattccctagccttagcaatttacaacgttcag
caaagttttgaccctgacaaaattgtaattggcggtggcatttctaataatccagaatta
attccgttattgaatcgcgaaattgactatattcgcaaacaagtcaatccagcaagtatt
aaacctgaaattgtgctttgcagtttgaagagtaatgcaaacttacgtggcgcagttgca
gattttgaacaagcacattaa

DBGET integrated database retrieval system