KEGG   Lactobacillus crispatus: LCRIS_01007Help
Entry
LCRIS_01007       CDS       T01222                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCRIS_01007 (pfk)
   01230 Biosynthesis of amino acids
    LCRIS_01007 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_01007 (pfk)
   00030 Pentose phosphate pathway
    LCRIS_01007 (pfk)
   00051 Fructose and mannose metabolism
    LCRIS_01007 (pfk)
   00052 Galactose metabolism
    LCRIS_01007 (pfk)
  Energy metabolism
   00680 Methane metabolism
    LCRIS_01007 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LCRIS_01007 (pfk)
Enzymes [BR:lcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LCRIS_01007 (pfk)
Protein phosphatases and associated proteins [BR:lcr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LCRIS_01007 (pfk)
Messenger RNA biogenesis [BR:lcr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LCRIS_01007 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1015706..1016668
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFVPLTTENVDHK
ISEGGTFLYSARFPEFAQEEVQQKGVEQLKKHGIDAVIVIGGDGSYHGALALTRHGVNSV
GLPGTIDNDIPYTDYTIGFDSACRTAMDAIDKIRDTASSHHRVFVVNVMGRECGDIAMRV
GVASGADAIVIPERSYDVKEIAETLTRGFADGKDHGIIVLAEGVMAADKFKDELLKYGDF
DARANVLAHMQRGGSPTVTDRVNATKMGNYAVKLLLDGKGGLAVGMENGELNTHDILDLF
DGKHQGDYALLDVNEEMTKY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggcggagacgcccctggtatgaatgcagcaatt
agagctgtgacaaagactgctatccatcatgggcttgaagtctttggaattcgttatggt
ttcgctggtttggttgcaggtgactttgttccgcttaccacggaaaatgttgaccacaag
attagtgaaggcggtactttcttgtacagtgctcgtttccctgaatttgcacaagaagaa
gtgcaacaaaagggtgttgagcaattaaagaaacatggtattgatgcggttatcgtaatt
ggcggagacggttcataccatggtgctttagccttgactcgccacggcgtaaactcagtt
ggtttgccaggaactatcgataatgatattccttatactgactacacgatcggctttgat
tctgcttgtcgtactgctatggatgctatcgataaaattcgtgatactgcaagcagtcac
caccgcgtattcgttgttaatgtaatgggtcgtgaatgtggtgatatcgctatgcgtgtc
ggtgtagcaagtggagcagacgcaattgtaattcctgaacgttcatacgatgttaaggaa
attgcagaaactcttactcgtggttttgcagatggcaaagatcatggtatcattgtttta
gcagaaggcgttatggctgctgataagtttaaggacgaactccttaaatatggtgacttt
gatgctcgtgctaatgtccttgcgcatatgcaacgtggtggctcacctactgttacagat
agagttaatgctactaagatgggtaattatgctgttaagttacttctcgatgggaagggc
ggtttagctgtcggcatggagaatggtgaacttaatacccacgacattcttgatttgttt
gacggtaaacaccaaggtgattatgcgttattggatgtaaatgaagaaatgactaaatat
taa

DBGET integrated database retrieval system