KEGG   Lactobacillus crispatus: LCRIS_01233Help
Entry
LCRIS_01233       CDS       T01222                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LCRIS_01233 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCRIS_01233 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LCRIS_01233 (thrC)
Enzymes [BR:lcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LCRIS_01233 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235084..1236574
Genome map
AA seq 496 aa AA seqDB search
MQYRSTRGSKENTLTAPQAIIQGLAQDGGLYVPVAFPQANFKLEDLSKLSYKQIAAMVIS
LFFDDFTKEQITTAVQSAYSEQWDDRSIVPIEKHDNRFYMELFHGPTLAFKDIALQMLPQ
LMTRAVQIEKIAKDIIILTATSGDTGTASMRGFANQKGTDVIVFYPEGGVSPVQLKQMLS
QRGNNLRAIAIKGNFDDAQTEVKKIFNDDSFKNRLNANGYQFSSANSMNIGRLVPQISYY
LYTYGQLVRRQEIKLGDEVNFAVPTGNFGDILAGYYAKKLGLPIKKLICASNENNVLTDF
FNNGVYDKRRKFHLTNAPAMDILVSSNLERLLFDLYDENNYEVASLMNQLTQRGHYQVSS
EVFTKLQKNFAAGFATEEEVKSEIKRVYNYDRYVIDPHTAVGSFVANQYQKKTGDQTPMV
IVSTASPYKFPETVYEAITGGPSMQTGVGAIKELHDELGGQLSIGVRALFDREPKTEKII
EPNDMEKEISSILDLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcgtagtactagaggttcaaaagaaaacactttaactgcacctcaagcaatt
attcaaggcttagctcaagacggtgggctttacgtgcctgttgcctttcctcaagctaat
tttaagttagaagatttatccaaactttcctacaagcaaatcgctgccatggttattagc
ttattctttgatgactttactaaggagcaaatcaccactgcagttcaaagcgcttatagt
gaacaatgggatgatcgcagcattgttccaatcgaaaagcacgataaccgtttttacatg
gagctttttcacggtcctacccttgccttcaaagatatagctttgcaaatgttgccacaa
ttaatgaccagagctgttcaaattgaaaagattgctaaagatattattattttaaccgct
acttctggcgatactggtacggcatcaatgcgtggctttgctaatcaaaagggtaccgat
gtcatagtcttttatcctgaaggtggcgttagtcctgttcaacttaagcaaatgctcagc
caacgcggcaacaatttgcgtgcaattgcaatcaaaggtaactttgacgatgctcaaact
gaagttaaaaaaatcttcaacgatgattctttcaaaaaccgacttaatgctaatggctat
caattttcttcagctaattcgatgaatattggtcgtctggttccgcaaatttcttactac
ctctacacctatggacaattagtacgcagacaagaaattaaactaggagacgaagttaac
tttgctgtgccaacaggtaactttggtgacatcctagctggatattatgctaagaaatta
ggtttgcctattaaaaagttgatttgtgcatctaatgaaaacaatgtattgactgatttc
tttaataatggtgtctacgataagcgacgtaagttccatttaaccaatgcaccagcaatg
gatatcctagtttccagcaatttggaacgacttttatttgacctttatgacgaaaataac
tatgaagtcgctagtttaatgaatcaattgactcaacgcggtcattatcaagttagcagt
gaagttttcactaaattacaaaaaaattttgcagctggttttgcaacagaagaagaggtt
aaatcagaaatcaaacgggtctacaattatgaccgctatgtaattgatccacatactgct
gttggctcttttgtagcaaatcaatatcaaaagaagaccggcgatcaaaccccaatggtc
attgtttcaacagccagtccatataagttcccagaaacggtgtatgaagccatcactggt
ggtcctagtatgcaaactggcgtcggtgcaattaaagaattgcatgatgaattaggcggt
caattatcaatcggtgtgcgtgccctttttgatcgtgaacccaagaccgaaaaaattatt
gaaccaaatgatatggaaaaagaaatcagttcaattttagatttgaaataa

DBGET integrated database retrieval system