KEGG   Lactobacillus crispatus: LCRIS_01235Help
Entry
LCRIS_01235       CDS       T01222                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCRIS_01235
   01230 Biosynthesis of amino acids
    LCRIS_01235
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_01235
  Energy metabolism
   00680 Methane metabolism
    LCRIS_01235
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCRIS_01235
Enzymes [BR:lcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCRIS_01235
Exosome [BR:lcr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCRIS_01235
  Exosomal proteins of melanoma cells
   LCRIS_01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1238052..1238612)
Genome map
AA seq 186 aa AA seqDB search
MTTVYFVRHAQPDLSVHDDLTRPLTEKGLQDRKKVTDYFRDKHIDQAFSSPFKRAIDTIQ
PVIDEKKLTLSSISDFRERKIGDEWISNFHEYCERQWEDFDYKLRNGESLKETQERNVAA
LKLVLSKYQDQTMIIGGHGTAIGSVINYYDPSFKYEAFAMIQPKNPFIVKMSFDGEKYLE
YKVVTF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagtatattttgtaagacatgctcaacctgatttatcagttcatgatgattta
acacgtcctttgacagaaaaggggttgcaagatagaaaaaaagtaactgattactttaga
gataaacacatcgaccaagctttttctagtccattcaagcgtgcaattgatacaattcaa
ccagttatagacgagaagaaactaacattatcatctatttctgactttagagaaagaaaa
attggtgatgagtggatttctaattttcatgaatattgtgaaagacagtgggaagatttt
gattataagctaagaaatggcgaatctttaaaagagacgcaggagagaaatgttgcagct
ttgaagctagttttgtccaaatatcaagatcaaactatgattattggtggacatggtaca
gcaattggatcagtaattaattactatgatccaagctttaaatatgaagcctttgctatg
atccagccaaagaatccatttattgtgaaaatgagctttgatggagaaaaatatttggag
tataaagtagttactttttag

DBGET integrated database retrieval system