KEGG   Lactobacillus crispatus: LCRIS_01334Help
Entry
LCRIS_01334       CDS       T01222                                 

Gene name
gmk1
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lcr  Lactobacillus crispatus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LCRIS_01334 (gmk1)
Enzymes [BR:lcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LCRIS_01334 (gmk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1343756..1344370)
Genome map
AA seq 204 aa AA seqDB search
MADKGLLLVLSGPSGVGKGTVKSAIVENKVFPFEYSVSMTTRQPRPGEVNGQDYFFVSED
RFQEAIKNGELLEYNKYVGHYYGTPLAPVKKMLHDGKDVLLEIDVNGAQKVREKMPDGVF
IFLTPPDLHTLHLRLEHRGTESEDVICGRIKQARNEILEMEDYDYAVVNDTVANAVDHIK
AIVDAEHVSVKRVIDDYRKMVKED
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaggtttattacttgtgctttctggtccttccggcgttggtaaaggaact
gttaaaagcgcgattgttgaaaacaaagtctttccatttgaatattcagtttcaatgact
acgcgtcaaccgcgaccaggtgaggttaatggccaagattatttttttgttagtgaagat
cgctttcaagaggctattaaaaatggtgagttgttagaatataataaatatgtcggtcac
tattatggtacacctcttgcaccagtgaagaagatgcttcatgatggcaaagatgtttta
cttgagattgatgttaatggggcacaaaaagtacgtgaaaagatgcccgatggcgtgttt
atctttttaaccccaccagatctacatacgttacatttgcgtttggaacaccgtggcacc
gagtcagaagatgtaatttgtggtcgaattaagcaagcgcgcaatgaaattttggagatg
gaagactatgattatgcagtagttaatgatacagtagctaatgcagttgatcatattaaa
gcgatcgtcgatgcagaacatgtcagtgttaaacgtgtaattgatgactatcgtaagatg
gtcaaggaggattaa

DBGET integrated database retrieval system