KEGG   Lactobacillus crispatus: LCRIS_01383Help
Entry
LCRIS_01383       CDS       T01222                                 

Gene name
dapE1
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lcr  Lactobacillus crispatus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lcr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lcr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1389697..1390362)
Genome map
AA seq 221 aa AA seqDB search
MVGEPSGYSIAIAHKGSMDIKLTSQGKEAHSSMHEKGYNAIDPLMDLLVKANKAFRETDK
NNPDLGNLTFNTTVFNGGEQINMIPGEATAQINVRTIPEFNNSLVEKKLTELVKTENAQG
AKIKMDIYMSEPSIKTNGKSEFVKLAQKIGAKYAEKPIPTVAIKPVTDASNLIADKGPSY
PFAMFGPGNDTPHQVNEYVDEKMYLNFVKIYTELFVAYLNK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttggttggtgaaccttctggctacagtattgccattgctcataagggttcgatggatatt
aagttaacttcccaaggcaaggaagctcatagctcaatgcatgaaaagggttataatgcg
atcgatccattaatggatttattagttaaggccaataaggcttttagagaaacggataaa
aacaatccagacttaggcaatttgaccttcaatactactgtcttcaatggtggggaacag
atcaacatgattcctggggaagctaccgcgcaaattaatgtgcggactattcctgagttc
aataatagtttggttgaaaagaaactaactgaattagttaaaactgaaaatgcgcaagga
gctaagatcaaaatggacatctatatgtcggagccttcaattaaaactaacggtaagtct
gaatttgttaaattagctcaaaaaattggggcaaaatatgcggaaaagccgattccaaca
gttgctattaaaccagtaactgatgcttcgaatttgattgccgacaaaggacctagctat
ccgtttgccatgtttggtcctggtaatgacacgccgcaccaagttaacgaatatgttgat
gaaaagatgtatttgaactttgttaagatctatactgaattgtttgtggcctatttgaat
aaataa

DBGET integrated database retrieval system