KEGG   Lactobacillus crispatus: LCRIS_01402Help
Entry
LCRIS_01402       CDS       T01222                                 

Gene name
gtfA2
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lcr  Lactobacillus crispatus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LCRIS_01402 (gtfA2)
Enzymes [BR:lcr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LCRIS_01402 (gtfA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1409536..1410978)
Genome map
AA seq 480 aa AA seqDB search
MAIKNKVMLITYPDSLGKNLKELNEVLHEDLKGAVGGIHLLPFFPSTGDRGFAPTDYTTV
DPKFGDWSDIEKLGEEYYLMFDFMINHISRHSKYYEDFQKNKDQSPYADLFLSWDKFWPK
GRPTKEDVDLIYKRKDRAPYQEITFADGTKEKLWNTFGPEQIDLDVRKRVTQKFIKETLV
SLIHHGADIIRLDAFAYAVKKLDSNDFFVEPEIWDLLKQVQDDIADEGATILPEIHEHYS
MPFKIAKHGYFIYDFALPMVTLYSLYSGKSNRLAAWLKKCPMKQFTTLDTHDGIGVVDAR
DILSPEEINYTSQELYQVGANVKKKYSSAEYHNLDIYQINTTFYSALGDDDQKYFMARLL
QVFAPGIPQVYYVGMLAGKNDLELLEKTKEGRNINRHYYSRQEVAEEVKRPVVSSLLKLF
TFRNTEPAFDLDGSIEISTPNENEIQIIRKNKEQTSQAELKANLKDLTYQVVVNGKEVKF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaaaacaaagtaatgttgattacttaccctgatagtttaggtaagaatcta
aaagaattaaatgaagttttacatgaggacttaaaaggcgcagttggtggcattcacttg
ttgccgtttttcccatcaactggtgatcgcggctttgctccaactgactatacaacagta
gatcctaaatttggcgattggtcagacattgagaaattaggcgaagaatattacttaatg
tttgactttatgattaatcatatttcgcgccattccaagtattatgaagatttccaaaag
aataaagatcaaagtccttatgcagatttattcttaagctgggataaattctggccaaaa
ggtcgtccgaccaaagaagatgtggacttaatctataaaagaaaagatcgtgccccatat
caagaaattacttttgccgatgggacgaaagaaaaactttggaatacttttggtccggaa
caaattgatcttgatgtgcgtaagcgagtaacacaaaaatttattaaagagaccttagtt
agcctaattcatcacggagccgatattattcgattggatgcctttgcttatgctgttaaa
aagctagatagtaatgatttcttcgtagaaccagaaatctgggatttgcttaagcaagta
caagatgatattgccgatgaaggtgcaacaattttaccagaaattcatgaacactattca
atgccgttcaagattgctaaacatggttactttatctatgattttgctttgccaatggta
accttgtattcactgtattctggtaaaagcaatcgcttggcagcttggctgaaaaagtgt
ccaatgaaacagtttacgactttggatacacatgacggaataggtgtagttgatgcccgt
gatattctctctcctgaagaaatcaattataccagtcaagagctctatcaagttggcgct
aatgtaaagaagaagtattctagtgctgaataccataatcttgatatctaccaaattaat
actactttttactctgctttaggcgatgatgaccagaaatacttcatggcacggttattg
caagtctttgcgccagggatcccgcaagtttattacgtggggatgctggctggcaagaat
gatcttgaattactagaaaaaactaaggaaggacgcaacattaatcggcattattatagt
cgccaagaagtagctgaagaagttaaacgtccggtagttagttcactcttaaaattattt
acttttagaaatactgaacctgccttcgatcttgatggttcaattgaaatttctactcca
aatgaaaatgaaatccagattattcgtaaaaataaagagcaaactagccaagcagaatta
aaggctaatttaaaagatttaacttatcaagttgtagttaacggcaaagaagttaaattt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system