KEGG   Lactobacillus crispatus: LCRIS_01403Help
Entry
LCRIS_01403       CDS       T01222                                 

Gene name
galA1
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lcr  Lactobacillus crispatus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lcr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lcr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lcr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1410990..1413191)
Genome map
AA seq 733 aa AA seqDB search
MTKNLITFDEKNKVFHLHNDQISYLISIEDGGTLSHLYFGKSIKAYHGELRYPRLDRGFS
GNLPGSLDRTFSKDSLPQEYSSAGEMDFRTPAMIVRQPDGSNAVFLTYENYQIVPGKPEL
KGLPHAWAKNKDEAETLIITLKDKFSELRFDLLYTIYRDRSVIVRSTKVRNAGKETVKIE
KVASMQMDFVDRDFDMITLPGAHAHERRVERNKVNQGIHVYSSIRGTSSHQMNPFVALVD
QDTNEFAGDAYGFAFVYSGNHKFEVEKDPYAQTRIVVGINDYNFSWMLNAQESFQTPEVL
MVYSDQGLNKMSQAFHSIIHDRIMRSKYKDQVRPIVVNNWEATYFDFDEDKLKPIVDKAK
ELGIEMFVLDDGWFGHRDDDNSSLGDWQVFEKKFPHGLDHFANYVHQQGLKFGLWFEPEM
ISIDSNLYQKHPDYLMHVPGRTPSPARNQYLLDLGRAEVRNNIFDQMKAILDSGKIDYIK
WDMNRHLSDIYQADLPADRQGEVYHRYVLGLYNLLEKIVDRYPDLLIEGCSGGGGRFDAG
MAYYNPQIWASDDSDAIDRLTIQYGTSLVYPQSMMTSHVSVSPNEQNGRITPFKTRGIVA
MWGDLGYELDLTKLSESDQKAVAEQVAEYKKIRAVTQYGTFYRLKNAQEGNQCAWETVSA
DKNEVILSTVKVMASAQPYFTKTKLVGLDPNKQYEDQVTHQVYGGDELMNLGIYDPVEHG
DFMAYQYHFKAIN
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaacttaattacatttgatgaaaaaaataaagtttttcatttgcataatgac
caaatttcatatctgatttcaattgaagatggtggcacactaagtcacttgtatttcggt
aaaagtatcaaagcatatcatggtgaattgcggtacccacgacttgatcgaggcttttcg
ggtaatttacccggatcattagatcgtactttttcaaaagattctttgccacaagaatac
agtagtgcaggcgaaatggactttagaacgccagcaatgattgtgcgccaaccagacggt
tctaatgcagtatttttaacctatgaaaattatcaaattgtgccaggaaagcctgaacta
aaaggtttgcctcatgcatgggcaaagaataaggatgaagctgaaactttaatcattact
ttaaaagataagtttagtgagctgagatttgacttgctttatacaatttatcgtgatcgt
tcggtaattgtgcgttcgactaaagttagaaatgctggcaaggaaacggtaaaaattgag
aaagtagcttcgatgcaaatggatttcgtagatcgtgactttgacatgattacactgcca
ggtgcccatgcgcatgaaagacgggttgaacgaaacaaggttaaccaaggaattcatgtt
tattccagcattcgcggcacttcaagtcaccaaatgaatccatttgttgctttagttgat
caagatacaaatgaatttgctggggatgcatatggtttcgcctttgtttactctggcaat
cacaagtttgaagtagaaaaagatccgtatgcgcaaaccaggattgttgttggcattaat
gattacaactttagctggatgctaaatgcgcaagagagtttccaaacacctgaagtatta
atggtttattcagatcaaggtttgaataagatgagccaagctttccatagtatcattcat
gatcgcattatgcgaagcaaatacaaagatcaggttcggccaattgtggtgaataactgg
gaagcaacttacttcgattttgatgaagataagttaaagccaattgttgataaggctaag
gaattaggcattgagatgtttgtgcttgatgatggttggtttggccatcgcgatgatgat
aattcttccttgggcgattggcaggtctttgagaaaaaattccctcatggcctagaccac
tttgccaattacgttcatcagcaagggcttaagtttggtttgtggtttgaaccagagatg
atctcaattgattctaatttgtatcaaaagcatcccgattatttgatgcatgttcctgga
agaacaccaagtccagctcgtaaccaatacttgcttgatttaggccgagcagaagtacgt
aataatatttttgaccaaatgaaagcaattcttgactcaggcaagattgactacattaag
tgggatatgaatcgccacttgtctgatatttaccaagctgatttgccagcagatcgacaa
ggcgaagtctatcaccgttatgtattaggtctatataatttacttgaaaaaattgttgat
cgctatcctgacctcctaattgaaggctgctcaggtggtggcggacgctttgatgcaggc
atggcctattacaacccacaaatctgggctagtgatgatagtgatgcaattgatcggtta
acaattcaatatggaactagcttggtttatccacaatcaatgatgacttcgcacgtttcg
gttagtcctaatgaacaaaatggccggattacgccgtttaagacgcgtggtattgtcgca
atgtggggggatttaggttacgagcttgatttaactaaattaagcgaatcagatcaaaag
gctgttgctgagcaagtagctgaatataagaaaattagagcagttactcaatatggtact
ttttatcgcttgaaaaatgcgcaagaaggcaaccaatgtgcatgggaaactgtttcagct
gataaaaacgaagtaattttatctacagttaaggtcatggccagtgcacagccatacttc
actaagactaaattagttggtcttgatccaaataaacagtatgaagatcaggtaacccac
caagtatatggcggtgacgaattgatgaacctgggaatttatgatccggttgaacacggc
gatttcatggcttatcagtatcactttaaagcaattaactga

DBGET integrated database retrieval system