KEGG   Lactobacillus crispatus: LCRIS_01579Help
Entry
LCRIS_01579       CDS       T01222                                 

Gene name
nagZ
Definition
beta-hexosamidase a, glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lcr  Lactobacillus crispatus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lcr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lcr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1590740..1592443
Genome map
AA seq 567 aa AA seqDB search
MVDLSAKPYYLNKDQIKYVENTVKNMSTDEKVGQLFFVIGQDENKVDIKEFIKKYQPGGM
MYRPDAAEKIKREIATAQNTSKIPMFFAANLESGGNGIVSEGTWFGNPLQMAATDDPRSA
YELGNVSGEEAAQVGNNMSFAPIVDIDNNFRNPIMNTRTFGSDKNRVIRMADAQVKGLED
NKIIPVIKHFPGDGVDDRDQHLVSSVNSLSADDWMNSYGEIYHHLIDAGIPSVMIAHIMQ
PAWERKLEPGIEDKDLRPASSSKLLINGLLRNVLKFNGLAITDATPMIGYNAAMTRKDLL
PATINAGIDMILFNKNIDEDYRFIHEAIDNGTLSMERVDEAVTRILGTKLAQGIMNTKSE
LTLLPPKEINLHSDEHKKLAEAVAKKSVTLVKDRDQLLPLTPKKYPRVRLVVLGDSDDGG
FKEGGHVTQAFKNVLEKEGFKVTLFDRKNLDFHEMFEEGVEDMEKKFDLAFYVANVETAS
NQTTTRLDWIHLMAADSPWYMKSIPTVFVSTANPYHLYDIPNVSTFINAYTGNQASIDAI
MRKVTGKEKFEGKSPVDPFCGDFTTRL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatttatctgcaaaaccatattacttaaataaagatcaaattaaatatgttgaa
aacactgttaaaaatatgtccactgatgaaaaagtaggtcaattgttcttcgttattggc
caagatgaaaataaagtcgatatcaaagaatttattaaaaaataccaaccaggtggtatg
atgtaccgccctgatgccgcagaaaagattaaaagagaaatagcaactgcgcaaaacaca
agcaagatcccaatgttcttcgccgccaaccttgaatcaggtggtaatggaatcgtttct
gaaggtacttggttcggtaatcctttacaaatggccgcaactgatgatcctcgcagtgcc
tatgaactaggcaacgtatctggtgaagaagctgcccaagtcggcaacaacatgtccttt
gctccaattgtcgatattgataataacttccgcaaccctattatgaatactcgtactttt
ggtagtgataaaaatcgagtaattcgcatggctgacgctcaagttaagggccttgaagac
aacaagattatccctgtaattaaacacttccctggcgatggtgttgatgatcgtgaccaa
catttggtaagttcagttaactcattaagtgctgatgactggatgaattcttatggtgaa
atttaccatcacttaattgacgcaggcatcccatccgtaatgatcgctcacattatgcaa
ccagcttgggaaagaaagttagaacctggcatcgaagacaaagatttgcgtcctgcttca
agctctaagcttttaatcaatggtttgctcagaaacgtacttaaattcaatggtttagct
attactgatgctactccaatgatcggttataatgctgcaatgactcgtaaagacttactt
ccagcaaccattaatgccggcattgatatgattttatttaacaagaacattgacgaagat
taccgtttcattcatgaagcaatcgacaatggtactctttcaatggaacgtgttgatgaa
gctgtaactagaattttaggtactaagcttgctcaaggtatcatgaataccaagagtgaa
ctaactttattgccaccaaaggaaatcaatttgcacagcgatgaacacaagaagttagct
gaagcagttgccaaaaagtcagtaactttagtcaaagatcgtgatcaattattgccactt
acacctaagaaatacccacgcgttcgattagttgtgctgggcgattctgatgatggtggt
ttcaaagaaggtggtcacgttactcaagcctttaaaaatgttcttgaaaaagaaggtttc
aaggtaacactttttgatcgcaagaacttagacttccacgaaatgttcgaagaaggtgtc
gaagacatggaaaagaaattcgacctcgccttttacgttgcaaatgtggaaactgcaagt
aaccagactactactcgtctagattggattcacttaatggctgccgattcaccttggtac
atgaagagcattccaacagtatttgtatcaactgccaacccataccacctctacgacatt
cctaatgtttcaacatttattaatgcctacacaggtaatcaagcttcaattgatgccatc
atgcgtaaggtaactggtaaagaaaaatttgagggtaagagtcctgttgatccattctgt
ggtgactttactactagattgtaa

DBGET integrated database retrieval system