KEGG   Lactobacillus crispatus: LCRIS_01680Help
Entry
LCRIS_01680       CDS       T01222                                 

Gene name
bglA6
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCRIS_01680 (bglA6)
Enzymes [BR:lcr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LCRIS_01680 (bglA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1710984..1712459)
Genome map
AA seq 491 aa AA seqDB search
MDYYQVPEGFMWGVATSANQVEGGWNEDGKGMSIADCERYNSYQNLNDYKKVNDMTTAEI
QAALKDKTTKAWGKRHGVDFYHHYKEDIATLAKTGINSFRISIAWSRIYPNGDDEKPNEA
GLRYYDSLFQTMIDNGIQPVVTLSHYEMPLNLVLKYDSWYDKRVISFFTQFAQTVITRYH
NLVNYWIPINEIDSIIRHPYSSAGLVKDRFPNLNFDEVTMHNQFVAAAWITKFIHDKYPN
AKVGSMITSTMVYPYTSDPRNMLKATQIMRKSYNFSDIQLRGKYPKVLLKHIHDLNVHVK
MTDTELKLIKENTADFVAFSYYSSVCTAYDTTGLKVTKANRTTGVYNKYLPESDWGWQID
PVGLRIILINLYDRYQKPLFIVENGLGAKDKLTLDGKVHDQYRIDYLRKHISQMLLSLKD
DGIELMGYMVWGTTDMVSASTTQMSKRYGLIYVDLNDEGDGTYKRYLKDSYFWYQKLLSY
KNKIPTMFFNK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggattattatcaagtgccagaaggttttatgtggggcgtagcaacttcagcaaatcaa
gtagaaggtgggtggaatgaagacggcaaaggtatgtcgattgctgattgtgaacgttat
aattcttatcagaatttgaatgattataagaaagttaatgatatgaccactgctgaaatt
caggcagcacttaaagataaaactacaaaagcttggggtaaacgtcatggggttgatttt
tatcatcactataaagaagatattgcaactttagcaaaaactggaattaattcctttaga
atttcaattgcctggagtcggatctatccaaatggggatgatgaaaaaccaaatgaagca
ggtttgagatattatgattcattatttcagacaatgattgataatgggattcaacctgta
gttactctgtcacactatgaaatgcctttaaatttagtattaaaatatgactcttggtat
gataaaagagttatcagcttttttacccaatttgctcaaactgtgattactagatatcac
aacttagtaaactattggattccgattaatgaaattgatagtataattcgtcatccatat
tcttctgctggtttagttaaagacagatttcctaatctcaattttgatgaagttacaatg
cataatcagtttgtagcagcagcttggattaccaaattcattcatgataagtatccaaat
gcaaaagttggaagtatgattactagtacaatggtctatccatatactagtgaccctcgc
aatatgcttaaagctacacagattatgcgtaaaagttataattttagtgatattcaactt
agagggaaatatcctaaagtattgttaaaacacatacatgatttaaatgtacatgtaaaa
atgactgatacagaattaaagcttatcaaagaaaacactgcagattttgtggcattttct
tattactcttctgtatgtacagcttatgatacgactggcttaaaagttaccaaggctaat
cgaactactggtgtgtacaacaagtatttaccagaaagcgattggggctggcaaatcgat
ccagtagggttgagaatcatattaataaatttatatgatcgttatcagaaacctctgttt
attgtagaaaatggattaggtgccaaagataaattaaccttagacggaaaagttcatgat
caataccgtattgattatttacgtaaacatattagtcaaatgctcctttctctcaaagat
gatggtattgaacttatgggttatatggtctggggtacaacagatatggtttcagcatcg
acaactcaaatgagtaaaagatatggtttgatttatgttgatctcaatgatgaaggcgat
ggtacatataaaaggtatttgaaagattcatatttctggtatcagaaattactttcctat
aaaaataaaattccgactatgttttttaataaataa

DBGET integrated database retrieval system