KEGG   Lactobacillus crispatus: LCRIS_01837Help
Entry
LCRIS_01837       CDS       T01222                                 

Gene name
murE2
Definition
UDP-N-acetylmuramoyl-l-alanyl-d-glutamate--l-lysi ne ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lcr  Lactobacillus crispatus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LCRIS_01837 (murE2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LCRIS_01837 (murE2)
Enzymes [BR:lcr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LCRIS_01837 (murE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1854956..1856527)
Genome map
AA seq 523 aa AA seqDB search
MSISLNTCILILKEHHLLKSSAVQDTVATKMDYVSYDSRDIQTNTLFFCKGAGFRPTYLS
MAKDNGAICYVAEQPYPEGKGMHALIVRDVSKAMALLSAAFFRFPQDDLFVVAFTGTKGK
TTSAYFLKGMLDQANGGKTALISSVNDVVGPKPEDSFKSSLTTPESLDLFRDMRTAVDNG
MTHLVMEVSSQAYKKNRVFGLTYDLGFFLNISPDHIGPNEHPNFADYLHCKLQLLVNSRK
CIINAETAHFDEVYAAATTTTNPDSIYLFARDNFENPDLKQPIDFRFSSEQLDMKETRFN
LVCASDKARKLPINGDYTLKMLGDFNESNGTAAIIGAGLAGLNHDQCAKGIRDVTIPGRM
QTERTKKHGMVVVDYAHNKASMMALMRFMRNEFNDPKIIVIVGAPGDKGVSRRPGFSESL
TAYADKAFLTTDDPGFEDPKSIAEEIDSGIDHSKCDVTIELDRNKAIHDAIAMATPDDVV
LICGKGADAFQKIRGVNTPYPSDIVVAQQVINELEGQEEHFRK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttccttaaatacctgtatattaatcttaaaagagcatcacttgctcaagtca
agcgcagtgcaagatacagtagctactaaaatggactatgtgtcttatgactcacgcgat
attcaaactaatacattgttcttctgcaagggagcaggctttagaccaacttatttgtca
atggctaaagacaatggggccatttgttatgtagctgaacaaccatatccagaaggaaaa
ggaatgcacgctttaattgtgcgcgatgtttctaaggcaatggctcttttgtcagctgct
ttcttccgttttccacaagatgacttgtttgttgtagctttcactggtacaaagggaaag
actacatcagcatactttttgaaagggatgcttgatcaagcaaatggtggtaagacagct
ctgatttcttcagttaatgatgtggtcggtcctaagcctgaagatagctttaagtcaagc
ttgaccacaccagagagtttggacttattccgagacatgagaacggctgttgataatggc
atgactcacttggtaatggaagtttctagtcaagcatataagaaaaatcgtgtcttcggt
ttaacttatgatttaggctttttcctgaatattagtccagaccatattggtcctaacgaa
caccctaattttgcagattatttgcactgcaaattacaattgcttgttaactcacgtaaa
tgtattatcaacgctgaaactgcacactttgatgaagtctacgctgccgcaacaactact
accaaccccgatagtatttatttgtttgcccgcgataattttgaaaatccagacttgaag
cagccaattgatttcagattctcttctgaacaattagatatgaaagaaactcggttcaat
ttagtttgtgctagtgataaggcacgtaaattgccaattaatggtgattatactttaaag
atgctgggtgatttcaacgagtcaaatggtactgccgcaattattggagcaggcttggct
ggacttaaccatgatcaatgtgcgaagggtattcgcgatgttactattccaggccggatg
caaaccgagagaacaaagaagcacggcatggttgtagttgactacgctcataataaggcc
tcaatgatggctttaatgagatttatgcgtaacgaattcaacgatcctaaaattattgtt
attgttggagctcctggtgataaaggcgtgtcacgtcgtcccggttttagtgaaagtttg
actgcatacgcagataaagcatttttaactacagacgatccaggctttgaagatccaaag
agtattgccgaagaaattgattcaggaatagatcactctaagtgcgacgttactattgag
ttagatcgtaataaggccattcatgatgcgattgccatggctacgccagatgatgttgtg
ctaatctgtggtaagggggctgacgctttccaaaaaattcgcggagtaaataccccatat
ccatctgatattgtggttgcacagcaggtaattaatgagttggaaggtcaagaagaacac
tttagaaagtaa

DBGET integrated database retrieval system