KEGG   Lactobacillus crispatus: LCRIS_01907Help
Entry
LCRIS_01907       CDS       T01222                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lcr  Lactobacillus crispatus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LCRIS_01907 (glpK)
Enzymes [BR:lcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LCRIS_01907 (glpK)
Exosome [BR:lcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCRIS_01907 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1924122..1925624)
Genome map
AA seq 500 aa AA seqDB search
MTEKYILAIDEGTTSTRAIIFDHDGREVASAQKEFHQYFPEPGWVEHDANKIWMAVQTTI
ANAFINSGIWPNQIAAIGITNQRETTVVWDKDTGEPIYHAIVWQSRQTTELAEKLKKEGY
SDEIRQKTGLIIDPYFSATKIRWILDHVPGAQEKAEQGKLLFGTIDSWLVWKLTDGAKHV
TDYTNASRTMLFNIHTLKWDDDILHLLNIPKQMLPEVRSNSEIYGETASYMFFGGQVPIA
GMAGDQQAALFGQLALKPGMVKNTYGTGAFIVMNTGDKPTDSNNNLLTTIGYGINGKITY
ALEGSIFVAGSAIQWLRDSMKLIKHAPDSEQAALESTSENEVYVVPAFTGLGAPYWDAET
RGSIFGVTRGTTDKDIIKATLQSLAYQTRDVVDTMQQDSGIEIPALRVDGGASNNNYLMQ
FQADILGIEIERAKTLETTSMGAAFLAGLAVGYWKNIDELKHTFTIGQAFEPKMSAVERE
KLYSGWQRAIRAARLFAHGE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaatatattttagcaatcgatgaaggaaccacctctactagagcaattatt
tttgaccatgatggacgtgaagttgcttctgcccaaaaagaatttcaccaatatttccca
gagcctggctgggttgaacatgacgctaataaaatctggatggcggtccaaacaacaatt
gccaatgcttttattaattcgggcatttggcctaatcaaattgccgcaattggcattacc
aaccaacgtgaaacgaccgttgtttgggacaaggatacaggtgagccaatttatcatgca
atcgtttggcagtcacggcagacaacagaattagctgaaaaattaaaaaaagaaggctat
agtgatgaaattcgtcaaaaaacaggcttaattattgacccatacttcagtgcaactaag
attcgctggattcttgatcatgtacctggcgcgcaagaaaaagctgaacagggaaagttg
ctttttggcacgattgatagttggctagtttggaagttaactgatggtgctaaacacgtg
actgattacactaatgcttcacggaccatgctgtttaatattcacacgctcaagtgggat
gacgatattttgcatttgctcaatattcctaagcaaatgttgcctgaggtgcgctcgaat
tcagagatttatggtgaaacagcgtcatatatgttctttggtggacaagtgccaattgct
gggatggccggtgaccaacaggcagccttatttggtcaactagctttgaaaccaggaatg
gtgaaaaacacatatggcaccggtgcctttattgtgatgaacacaggggacaagccaaca
gactctaacaataatctgttaacgaccattggttatggcattaatggtaagattacttat
gctttagaaggatcaatctttgtggctggtagtgcaattcaatggctacgcgattcgatg
aagttgattaagcatgcgccagactctgaacaagcagcgcttgagtcgacatcagagaac
gaggtttacgttgtccctgccttcactgggttaggcgcaccatattgggatgcggagact
cgtggctcaatcttcggtgttacacgtggaactactgacaaggatataattaaagcaact
ttgcagtcattagcttatcaaacccgtgacgttgttgatacgatgcaacaagattcaggc
attgaaattcctgctttacgtgttgatggcggtgctagcaacaacaattacctgatgcag
tttcaggctgacattttagggattgaaattgaacgcgctaaaacgctggaaacaaccagc
atgggtgcagcctttttagctggccttgccgttggctattggaaaaatattgacgagtta
aagcatacctttacgattggacaggcctttgagccgaaaatgagtgcagttgaacgtgaa
aaactttattcaggttggcaacgtgcaattcgtgctgctcggttattcgcacacggggag
tga

DBGET integrated database retrieval system