KEGG   Lactobacillus casei BD-II: LCBD_0076Help
Entry
LCBD_0076         CDS       T01955                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LCBD_0076
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCBD_0076
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LCBD_0076
Enzymes [BR:lcs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LCBD_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(71559..72353)
Genome map
AA seq 264 aa AA seqDB search
MSKLADVFKNHKVFIPFIVADDPDFETTVKNVVALAKGGADIVELGIPFSDPVADGPVIQ
AADLRAFAANVRTKTVFDIVEAARKETAVPIVFLTYLNIVFKYGYEAFLKRCADLNVAGL
VIPDLPYESRDEIVPIAEKYGIDIIPLITPTSGHRIEKIAKSASGFIYVVSSMGITGERD
EFFAGLKALVAEIKQYTNVPTAIGFGIHTPEQAQTMAGIADGVIIGSAIVDLVAKEKQQA
PAAIEKFTKQIRVSVDAKKQISVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagcagatgtttttaaaaatcataaagtctttatccccttcatcgtcgct
gatgatcccgattttgaaaccaccgtcaaaaacgtggtcgcacttgccaaaggtggcgcc
gatattgtggagttaggcatccctttttccgatccagtcgccgacggtcccgtgattcaa
gccgccgacctaagagcattcgccgccaacgttcgcaccaaaacggtctttgacattgtg
gaggctgcccgcaaagaaaccgcggtgccaatcgtcttcctaacttacttgaacattgtc
ttcaaatacggctacgaagccttcttaaaacgctgtgcggatttaaatgtcgccggcttg
gtgattccagatctgccatatgaaagtcgcgatgaaattgtgccaattgccgaaaaatac
ggtatcgatattattccgttaatcacgccaacttccggtcatcgaattgaaaaaatcgcc
aaaagtgcctcaggatttatctatgtcgtttcctcaatgggcattactggcgaacgcgat
gaattctttgctggcttaaaggcattagtcgcagaaattaagcagtataccaacgttcca
accgctatcggtttcggcattcacacgcctgaacaagcacaaacaatggcaggcatcgcc
gatggtgtcatcatcggcagcgccatcgttgatcttgtcgcgaaggaaaaacaacaggca
ccggctgcgattgaaaagtttactaagcagatccgagtgtccgttgatgctaaaaagcaa
atttcggtgaaataa

DBGET integrated database retrieval system