KEGG   Lactobacillus casei BD-II: LCBD_0212Help
Entry
LCBD_0212         CDS       T01955                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lcs00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lcs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
204755..206308
Genome map
AA seq 517 aa AA seqDB search
MALSLRACILLLKEHHLLKSAAIQNTEDVDMTGIAYDSRKVSGPTLFFCKGDKFRPIYLS
MAKDNGARTYVAEKPYVEGNGLNALIVRNITKAMAILSAAFFDYPQDDLFVIAYTGTKGK
TTASYFTEAILNEARPRHIALFSTIDTVVGPESDQRFKSNLTTPESLDLFRDMREAVENG
MTHLVMEVSSQAYLRNRVFGLTYDVGFFLNITPDHIGPNEHPTFANYLHNKLQLLVNARK
VVINAETEHFDQVYAAATTTTYPESIYLFASAGFRPKRDDIDIDFRFDSQEADVAESRFT
LVPVTEKAAALNIGGHYSLALIGDFNESNATAAIIGAGLAGVDASAAVPGIAKVKIPGRM
EHTKVAGHGAVYVDYAHNYASMKALLSFLKHAYKDPRLLVVVGSPGDKGVSRRPGFAKVL
TEFATEAFLTTDDPGYEDPANIIEEIDSKIDHSKVKVHKVLDRQKAIAEAISDSRPNDIV
VVAGKGADPYQKVRGVNTPWPTDMAVVKQVAKSLQEG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcactatcacttagagcatgtatcttattattaaaggaacatcatctgctaaagagt
gcagcaattcagaatactgaagatgtcgatatgaccggcatcgcctatgattcacgcaag
gtctctggaccaacgctgtttttctgcaaaggcgacaagttccgaccaatttatctttcc
atggccaaggacaacggtgcgcgaacttatgttgccgagaaaccttacgttgaaggcaac
ggcttaaacgccttgatcgtgcggaatattactaaagcaatggcgattttgagcgctgct
ttctttgattatccgcaagatgatttgtttgtgatcgcttatacaggaaccaaggggaaa
accacggcttcctattttacagaagctattttaaatgaggctcgtccacgacacatcgcg
cttttttctacaattgatacggttgttggccctgagtccgatcagcgtttcaagtctaat
ctgacaacgccagagagcctcgatcttttccgcgatatgcgcgaggctgtcgaaaacggt
atgacccatctcgtgatggaagtgtcgagtcaggcatatttgcgcaatcgcgtttttgga
ttgacgtatgacgtcggcttcttcctgaacattacgccagatcacatcggaccgaatgaa
catccaacctttgctaattacttacacaacaagctgcaattgttggtcaatgcgcgcaaa
gtggtcattaatgccgaaaccgagcattttgaccaggtttatgctgccgcaacgaccacc
acttatccagaaagcatctacctgtttgccagtgctggcttcagacctaaacgcgatgat
atcgatattgattttcgctttgatagtcaggaagctgacgttgctgagagtcgtttcact
ttagtaccagtcacggaaaaagcagcagcattgaacatcggcggtcactactcgcttgct
ttgattggtgattttaacgaaagtaacgcgacggctgctattattggtgctggattggct
ggcgtggatgcatctgccgctgttccgggtattgcaaaagttaaaatccccggccgcatg
gagcatacgaaagttgccggacatggtgctgtctatgttgattatgcgcacaactacgct
agtatgaaggcgttattgtcgtttttgaaacacgcttacaaggatcctcgattactggtt
gtggttggatcccccggtgataaaggtgtttctcgtcgtcccggatttgctaaggttctc
actgagtttgcaactgaggcattcttgactaccgacgatcctgggtacgaagatccagca
aacatcattgaggaaatcgatagtaaaatcgatcatagcaaagttaaagtacacaaagtg
cttgatcggcaaaaggccattgctgaagctattagcgacagcagaccaaatgatatcgtg
gtggtggctggcaaaggggccgacccctatcaaaaggtacgcggcgtcaacacaccatgg
ccaacagacatggctgttgtaaagcaagtcgctaaatcgctacaggaaggctga

DBGET integrated database retrieval system