KEGG   Lactobacillus casei BD-II: LCBD_0289Help
Entry
LCBD_0289         CDS       T01955                                 

Definition
galactosidase, beta 1-like protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LCBD_0289
Enzymes [BR:lcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LCBD_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292913..294709
Genome map
AA seq 598 aa AA seqDB search
MTTFSIDHEFMLDGQPFKILSGAIHYFRVHPSDWYHSLYNLKALGFNTVETYVPWNLHEY
NEGDFDFSGILDIERFLNTAKDLGLYAIVRPSPYICAEWEFGGFPAWLLTKKMRLRTDDP
AYLQAIDRYYTALMPHLVGHQVTHGGNVIMMQVENEYGSYGEDKDYLAAVAELMKKHGVD
VPLFTSDGPWPATLNAGSMADAGILTTGNFGSRADMNFDRLAAFNQAHGHDWPLMCMEFW
DGWFNRWGEPIIRRDPEETAEDLRAVIQRGSVNLYMFHGGTNFGFMNGTSARKDHDLPQV
TSYDYDAPLNEQGNPTPKYFTIQKMIHEVLPSQAQTTPLVKPAMRQADNPLTAKVSLFSV
LDQLAQPVAAPYPQTQEFLGQYTGYTLYRTNPLISGTDKGTPAKLRVIDARDRVQAFFDG
KSLATQYQEAIGDDILLPEVEGRHQLDLLVENMSRVNYGSKIEAITQFKGIRTGVMVDLH
FIKDYLQYPLDLNKAPQLDFTGDWQAGTPAFYQYGFDVVKPQDTYLDCRGFGKGVMLVNG
VNIGRFWGKGPTLSLYVPAGLLHTGHNEVIVFETEGQYAEAINLVDHPIFKELNTEEE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccttttcgatcgatcatgagtttatgttggacggtcagccgttcaagattctg
tctggcgcgattcattacttccgagtccatcccagtgattggtatcacagcctttataac
ttgaaggcactgggatttaacacggtagaaacctatgtcccttggaatctgcacgagtac
aacgaaggtgactttgatttcagcgggattctcgacattgaacgctttctaaacaccgca
aaggatcttggcttatatgccatcgtgcgaccatccccttacatctgcgcagaatgggag
ttcggcgggtttccagcatggctgttaacgaaaaagatgcgcttgcgaaccgacgatcct
gcctatctgcaagcgattgaccgatactacacagctttaatgcctcatcttgtgggtcat
caagtcacgcatggtggcaatgtcatcatgatgcaagtggaaaatgagtacggttcatat
ggcgaagacaaggactatcttgccgccgtggccgaacttatgaaaaagcatggcgttgat
gtcccgctttttacctcggatggtccctggccagcaaccttgaacgctggcagcatggcc
gacgctggtattttgactaccggcaattttggctcacgtgccgacatgaatttcgatcgg
ttggcggccttcaatcaagctcatggacatgattggccgttgatgtgtatggaattctgg
gacggctggttcaaccgctggggcgaaccgatcattcgccgcgacccagaagaaactgcc
gaggacttgcgagcggtgatccaacgcggcagtgtcaatctctacatgttccacggggga
actaattttggctttatgaacggtacctcagctcgcaaagatcatgatctaccgcaagtg
acttcctacgattacgatgcaccattgaatgagcaaggcaatccaacgccaaagtacttt
accattcagaaaatgatccacgaagtcttgccatcgcaggcccagaccacaccgctggtc
aagccagcgatgaggcaagcggacaatccgttgacggcgaaagtgtcattattctcagta
cttgatcagctagctcagccagtagccgcaccttatccgcagacacaggagtttcttggc
caatacaccggttatacgttgtatcgaacaaacccgctgatcagtggtaccgacaaaggc
acgccggctaagttgcgcgtgattgatgcccgtgatcgggttcaagccttctttgatggc
aagtcgctagcaacacagtatcaagaggccatcggcgatgacatcctgctcccagaagtt
gaaggccgccatcaactagatctgttggtcgaaaacatgagccgcgtcaactacggctca
aaaatcgaagcgattacccagtttaagggaattcgcaccggtgtcatggtagacctccat
ttcattaaggactacctgcaatacccacttgacttgaacaaggcgccgcaacttgatttc
accggcgattggcaagcagggacacccgctttttatcaatatgggtttgatgtggtgaaa
ccacaagatacgtatcttgattgtcgtggatttggtaaaggagtgatgctggtcaatggt
gttaacatcggcagattctgggggaaggggccaacgttgtcactatatgtgccagccggg
ttgcttcacaccgggcacaatgaggtcattgtttttgaaaccgaaggccaatatgccgag
gcgataaacttggttgaccacccaatatttaaggaactgaacacagaggaggaataa

DBGET integrated database retrieval system