KEGG   Lactobacillus casei BD-II: LCBD_0326Help
Entry
LCBD_0326         CDS       T01955                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCBD_0326
Enzymes [BR:lcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LCBD_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327987..328916
Genome map
AA seq 309 aa AA seqDB search
MPNHVVVIGSINVDSILHIQRLPQPGETIKMDTFSQAAGGKGANQAVAAARSGAKTSFIG
RVGDDANAAFMRGELVKNQIDTQYVATTVGTQTGQAYILLQASGQNSIIIQHGANFEVTP
ADVQRAADLIQSADFVVAEFETPVDATAEAFKIAKAAGKMTILNPAPAQKDLPAALLKNV
DLIAPNETESELITGIPVVDEDSMRASAAYYHELGIRGVIITLGSKGSFISLDGEATIVP
AFKVKAVDTTAAGDTFIGALASVLQTDLKNIVTAASYASMASSFTVQKLGAFPSIPMGDE
VRAALAKIK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcatgttgttgtcatcggcagtatcaatgtcgatagcatcttgcacattcaa
cggttgccacaaccgggagaaacgatcaaaatggacaccttttcgcaagcggctggcggt
aaaggggcgaatcaagcagttgcggctgcgcgttcgggggccaaaaccagttttattggc
cgagtcggtgacgatgccaacgctgccttcatgcgcggtgaacttgtcaagaaccaaatc
gacacccaatatgtggcgacaacggttggcacgcaaaccggtcaggcttacattttgctg
caagcctctggtcaaaattccattatcatccagcatggcgctaattttgaggtgacacca
gcagatgtgcaacgagcagccgacttgattcagtctgccgactttgtggtcgcggaattt
gaaacaccggtggatgcgacggcagaggccttcaaaattgccaaagctgctgggaagatg
accatcttaaacccagcgccggcacagaaggatttgccagcagccttgctgaaaaatgtg
gatctcatcgcaccgaacgaaaccgaaagcgagctgatcaccggcattccggtggtagat
gaagacagcatgcgggcttcggcagcttattatcatgaattaggtattcgcggtgtgatc
atcactttaggatcaaaaggctccttcatctcgctggatggcgaagcaaccatcgtgcca
gcctttaaagtcaaggctgtcgacaccaccgccgcgggcgacacgttcattggtgccttg
gcaagcgtcttgcagacagatcttaagaacattgtcacggcggcgagctatgccagcatg
gcaagttctttcacggttcagaaacttggcgccttcccgtccattccgatgggggatgag
gtgcgggcggcgttagcgaaaatcaagtga

DBGET integrated database retrieval system