KEGG   Lactobacillus casei BD-II: LCBD_0988Help
Entry
LCBD_0988         CDS       T01955                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LCBD_0988
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LCBD_0988
Enzymes [BR:lcs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LCBD_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
958279..958752
Genome map
AA seq 157 aa AA seqDB search
MSIYDYEVTLEDGSQYALSKYKGRPMLIVNTATKCGFAPQFDGLEKLYDKFKDQGLVVLG
FPSDQFKQELADGHAAAEACRLKYGVSFPMHDLIKVNGKEAAPLFQYLKTQAPGELGKSI
KWNFTKFLVDRDGQVVARFAPKTKPEAIEPAVEKLLG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgattatgaggtcacattagaagatggctcgcaatatgctttgagcaaa
tacaagggtcgaccaatgttgatcgtgaacactgccactaaatgcggcttcgcgcctcag
tttgatggtttggagaaattgtatgacaagttcaaggatcaaggtttggtagtgctaggt
tttccttctgatcaatttaaacaggaactggctgatggtcatgcagcggccgaggcttgc
cggttgaaatacggtgtgagttttccaatgcatgatttgattaaggtgaacggcaaagaa
gcagctccgctgtttcaataccttaaaacccaagcccctggtgaactaggcaagtccatc
aaatggaactttacgaagtttttggttgatcgtgatggtcaagttgtcgcccgctttgca
ccaaaaacaaaaccagaagcgattgaaccagcagtggagaagcttcttggctaa

DBGET integrated database retrieval system