KEGG   Lactobacillus casei BD-II: LCBD_1112Help
Entry
LCBD_1112         CDS       T01955                                 

Gene name
tpiA
Definition
phosphoglycerate kinase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCBD_1112 (tpiA)
   01230 Biosynthesis of amino acids
    LCBD_1112 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCBD_1112 (tpiA)
   00051 Fructose and mannose metabolism
    LCBD_1112 (tpiA)
   00562 Inositol phosphate metabolism
    LCBD_1112 (tpiA)
Enzymes [BR:lcs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LCBD_1112 (tpiA)
Exosome [BR:lcs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LCBD_1112 (tpiA)
  Exosomal proteins of bladder cancer cells
   LCBD_1112 (tpiA)
  Exosomal proteins of melanoma cells
   LCBD_1112 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074490..1075245
Genome map
AA seq 251 aa AA seqDB search
MRTPFIAGNWKMNKNPKETQEFLDGVKGKLPDASKVETVIGAPAIDLTTLVAGAEGTPLK
TAAENCYFEDEGAFTGETSPKALKEMNVDYVIIGHSERRGYFHETDEDINKKAKAIFKNN
LLPIICCGESLAQREAGQTEDWVASQIEAALAGLSADQVKVSVLAYEPIWAIGTGKTATA
DQAQEVVAHIRATVEKLYNKDTADAVRILYGGSVKPANVKELMAKPDIDGGLVGGASMDP
ESFIALANYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccattcattgctggtaactggaaaatgaacaaaaatcctaaggaaacgcaa
gaattcttagacggcgttaaaggcaagttgcctgatgcaagcaaggttgagactgtcatt
ggtgcacctgccattgatttgaccaccttagttgctggcgctgaaggcacacctttgaag
acggcggctgaaaactgctactttgaagacgaaggtgccttcactggtgaaaccagcccg
aaagctttgaaagaaatgaacgttgattacgtcattatcggtcacagcgaacgtcgcggc
tatttccacgaaaccgatgaagatatcaataagaaggctaaggccatctttaagaacaat
cttttgccaatcatttgctgtggcgaaagtttggctcagcgcgaagctggccaaaccgaa
gactgggttgcttcacagattgaagctgctttggccggtttaagtgctgaccaagtcaaa
gtttcagtcttagcctatgaaccaatctgggctatcgggacaggtaagacggcaactgcc
gatcaggcacaagaagttgtcgcacatattcgtgcaacggttgagaagttgtataataaa
gatacggcagatgctgttcgtattctttacggcggctctgttaaaccagcgaacgtcaag
gaattaatggctaagcctgatatcgatggcggcttagtcggtggcgcttcgatggatcct
gaaagtttcatcgccttggctaactaccaagattaa

DBGET integrated database retrieval system