KEGG   Lactobacillus casei BD-II: LCBD_1233Help
Entry
LCBD_1233         CDS       T01955                                 

Gene name
gtaB
Definition
glycerol-3-phosphate dehydrogenase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LCBD_1233 (gtaB)
   00052 Galactose metabolism
    LCBD_1233 (gtaB)
   00500 Starch and sucrose metabolism
    LCBD_1233 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    LCBD_1233 (gtaB)
Enzymes [BR:lcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LCBD_1233 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1203766..1204680
Genome map
AA seq 304 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGKQK
RSIEDHFDSAPELEQNLKEKHKDALLELVHSTTDIGVNLFFVRQPYPRGLGDAVRLAKSF
VGDEPFVVMLGDDLMHDKVPLTKQLINEYDKTHASILAVKKVPHDEVSAYGVIDPEKEVS
KGLFNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILENQKPGKGNEIQLTDAIDTLNQ
TQRVFAHEFTGDRYDVGNKFGYVKTNIEYGLTHPEVKDELRAYILDLASKLQANKPVGKP
ANKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttcgtaaggcagtcattccggcagccgggcttgggacccgctttctgccagca
actaaagctttagccaaagagatgttaccaatcgttgataaaccaaccattcagttcatc
gttgaagaggctaaggccagcgggattgaagacattctgatcgttgagggtaaacaaaaa
cgttctattgaggaccatttcgattctgctcctgaattggaacagaatttgaaagaaaaa
cataaagatgccttgttggagttggttcactccactactgacatcggcgttaatctcttc
ttcgttcgccagccatatccgcgcggccttggggatgccgttcgtttggcgaagtcattc
gttggcgacgaaccatttgttgtcatgctcggcgatgacctgatgcatgacaaggtaccg
ttgaccaagcaactgattaacgaatacgataagacccacgcatccattcttgctgttaaa
aaagtgccacatgacgaagtttcagcttatggcgttattgaccctgaaaaagaagtttca
aagggactcttcaacgtcaagaaatttgttgaaaagccagctgttgccgatgcaccaagt
gacttggccatcattggtcgttacttgttgacaccagagatctttgatattctcgaaaat
caaaaacctggtaagggtaacgaaattcaactcaccgatgccatcgacaccttgaaccaa
acccagcgtgtcttcgcccatgaattcaccggagatcgttatgacgttgggaataagttt
ggctatgtgaagaccaacatcgagtatggcttgacccatccagaagtgaaggatgagctg
cgtgcttatattcttgacttggcttcaaagctacaggcaaataagcctgtggggaagccg
gcaaataagaagtaa

DBGET integrated database retrieval system