KEGG   Lactobacillus casei BD-II: LCBD_1375Help
Entry
LCBD_1375         CDS       T01955                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LCBD_1375
  Amino acid metabolism
   00300 Lysine biosynthesis
    LCBD_1375
Enzymes [BR:lcs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LCBD_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1323908..1325098)
Genome map
AA seq 396 aa AA seqDB search
MLNKTRAQSLQQLTVATKDGAIMTEPIALLQKLIQINSVNGNELAVAKLLQAELEAADIP
TKLIPYTEDRVNLIAELNHGDRVLGFTGHEDVVSPGDESAWTYPPFSGKVVDNVMYGRGT
DDMKSGLAAMVLALIALKQSGFTHPIRLIATVGEEYGAMGARLLTEQGYADDLAGLVVGE
PTTKILKYAHAGTVNYEIDSEGVSVHSSRPEKGVNAIDGLTTFAALEHHAFDKAPADPDL
GPFRHSITVINGGDQVNTIPAHAFLRGNLRPTPSANIELVVKMLEDLVAHVNATTNAKLT
LKVLHRFLPVHSDKTGHLVTSANAAIAAVTGKPAELAVAFGGTDASEFIKSTNHFDVIVY
GPGDNHFSHQVNEHIDLNSYTTAIKIYQEIAKRFFE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaacaaaactcgcgcacaaagtctgcaacagctgactgtcgcgacaaaggatggt
gcaatcatgacagaaccaattgccctgctccaaaagctgattcaaatcaattctgtaaat
ggcaacgagctcgccgtcgccaaattgctgcaagccgaacttgaggctgccgatattcct
accaagctgatcccctacacagaagaccgcgtgaatttaattgccgaattaaaccatggt
gatcgcgttctcggtttcactggccacgaagatgttgtgagtcctggagacgagtcagcc
tggacgtacccacctttttccggaaaagtcgtcgacaatgtcatgtatggtcgtggcacc
gatgatatgaaaagcggtttagccgccatggtgctggccctgatcgccctcaaacaatcc
gggttcactcatccgattcgcttgattgcaacggtaggcgaagaatacggtgcgatgggc
gctcgtttgctgacagagcaaggctatgccgatgatctcgctggcttagttgttggtgaa
cccaccactaaaatcttaaaatatgcacatgctggcaccgtgaattacgagattgacagt
gaaggcgtctctgtccatagttctaggcctgaaaaaggcgtcaatgccatcgatggtcta
acgacttttgccgcactggaacatcacgcctttgataaggcgcctgctgacccggatctc
ggcccatttcgacattcaatcacggtcatcaatggcggcgaccaagtcaacaccattcca
gcccacgctttccttcgtggcaatcttcgcccgaccccatcggccaatattgagctggtt
gtgaaaatgcttgaagacttagtggcacatgtcaacgccacgaccaatgcgaaactcacg
ttgaaagtattgcaccgttttctgccggttcactccgataaaacaggccacttggtaact
tcggcaaatgctgccatcgcggcggtaactggtaaaccagctgaattagccgttgcgttt
ggaggaaccgatgcttccgagttcatcaaatcaactaaccattttgatgtgattgtctat
ggccccggtgataaccacttcagtcatcaagtgaatgaacacatcgacctgaacagttac
acaacggcgatcaaaatttatcaagaaattgccaagcgcttcttcgaataa

DBGET integrated database retrieval system