KEGG   Lactobacillus casei BD-II: LCBD_1504Help
Entry
LCBD_1504         CDS       T01955                                 

Definition
Exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LCBD_1504
Enzymes [BR:lcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LCBD_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1442956..1445424
Genome map
AA seq 822 aa AA seqDB search
MDTREETVTGRVKSIFFQNPTNFFKILLIEISATTITWTESDIVVTGTFGDIKEDATYTF
TGHVVDHPKYGQQFQADNYHADQPTNKSGLVDYLSSDKFPGIGPKTATKIIDHLGMDAID
KILDDPKVLAGLGMTAAKRDMLATNLKSNQGMERVIIGLNDYGFTSNMAGRIYQQYQNDA
LDVIKHNPYQLINDIDGIGFTRADQIAAKLAIAPTSQLRLGGAVMDTLQRLTDGEGDTYV
TLKSLVTQTLDLLERARNVAVSPDAVGQAIVTLAKDNALIAEGDRIFPKRLYDAEWQIGR
QLKGLAEADATATEPELAEIEKTLAAVEADTGIAYDATQRKAIVTALQSPIFLLTGGPGT
GKTTVTDGIVRTYARLHDLSLDLDQYTTDEPFPIMLAAPTGRAAKRISETTQLPASTIHR
LLGLGVDTQEFAPNELPNGLLIIDEMSMVDTYLFRTLLTALHPGMKIVLVGDKDQLPSVG
PGQVFADLLRSGVLPQTALTHIHRQDADSSIIPLAHAVNAGKLPDDFTKPQVDRSFLACA
PSQVPEVVGQVVQRAAVKQFSIADIQVLAPMYRGTAGIDRLNPLLQNILNPKRSARTKAI
QFGETEYRIGDKVLQLVNDPNQNVFNGEIGQIVGITLGKEAESKTDELTIDFDGNEITCK
RSDFNKITLAYATSIHKAQGSEFPMVILPLTLQSRRMLRRNLLYTAITRAKSFLILVGEL
AAFQEAVSEVAVNRHTGLVDRLMTVFGKTVAPQVADDSATKDISASPSEPQIDTTALDLD
NEVKQQPPAAHQLTPALVASQRIDPMIGMDGITPQMFMTKEN
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcgtgaggagactgtcaccggtcgggtcaaaagtatctttttccagaatcca
acaaatttttttaaaattcttctgatcgaaatctctgcgacgactatcacctggacagag
tcagatattgtggtgacaggaacgtttggtgatattaaggaagatgcgacctacacgttc
actgggcatgtcgtggatcatcctaagtatgggcagcagtttcaagcagacaattatcat
gcggatcagccgacgaataaaagtgggctggtcgattatttgagctcagataagttcccg
gggatcggtccgaaaacggcaacgaaaattatcgatcatttgggtatggatgctattgac
aagattctggatgatccgaaggttttggcgggcttaggcatgacagctgccaagcgtgat
atgttggcgacgaatctgaaatcgaaccaaggcatggaacgggttattattggtcttaac
gattacggttttactagcaatatggcaggtcgtatttaccaacaatatcaaaatgacgcc
ttagatgtgattaagcacaatccgtatcaattgattaacgatattgatggtatcggcttt
actcgggctgatcagattgcggcaaaattggcgattgcaccgacttcgcagcttcgtctt
ggcggtgcagtgatggataccctgcagcggttgactgatggcgaaggtgatacctatgtg
acgctgaagtcattggtcactcagacacttgatttattggaacgggcgagaaacgttgcc
gtttcgccagacgcagtaggacaggcaattgtgacgctggctaaagacaatgccctgatt
gcagaaggcgaccgcattttcccgaaacgattatatgatgctgaatggcagattggtcgg
caactaaaaggactggcagaggcagacgcaacggctactgaacctgaattggctgagatt
gaaaaaacgttagcggcggtcgaggcggataccggtattgcgtatgatgcgacgcaaaga
aaagccattgtcacggcgttacagtcgcccatttttctgttgactggaggacctggtact
gggaaaaccacagtaacagatggtatcgtgcggacgtatgcacggttgcatgacctttca
ttggatcttgatcagtatacgactgacgagccatttccaatcatgctggcagcgccaacc
gggcgggcagcgaaacggattagtgagaccacccaactgccagccagtacgattcatcgc
ctgctcggtttaggtgttgacacgcaagaatttgcacctaatgagttaccgaatggcctg
ttgattattgatgagatgtcaatggttgacacttacttgttccggacgcttttaacggca
ttacatcccggaatgaaaattgtcttggttggcgataaagaccagttaccaagtgtcggt
cccggacaagtattcgctgatttattgcgcagcggcgtgctgccgcaaacagcgctgacg
catattcatcgtcaggatgccgacagttcaattattccgctagcgcatgcagtgaatgct
ggcaagttgccggatgattttaccaagccgcaagttgatcgcagttttttggcgtgtgcg
cctagtcaggtacctgaagttgtcggacaagtggtgcaacgagccgcagtcaaacaattc
tcgatcgcggatattcaagtgttggcacctatgtaccgcggaaccgctggcattgatcgt
ttgaatccgttactgcaaaacattttgaatccaaaacgcagtgcccgaacgaaagcaatt
cagtttggagaaacggaatatcgaattggtgataaggtgttgcaactggtcaatgatccc
aaccaaaatgtttttaacggtgaaatcggtcagattgtcggcattactttgggcaaggaa
gccgaaagcaagacagatgaattaacgattgatttcgacggcaatgaaatcacttgcaaa
cgcagtgattttaataagattacgcttgcttatgccacctcgattcataaagcccaaggc
agtgagtttccgatggtgattttgccgctaaccttgcaaagccgccggatgttgcgacgt
aacttgttgtacactgccattacgcgggctaaatcatttttgattttggttggcgagctg
gcagcctttcaggaagcggtcagtgaagtagccgttaatcgacatactgggctggtcgat
cggctcatgactgtatttggcaaaaccgttgcccctcaggttgctgatgattcagcaacc
aaggatatttcagcaagtcccagtgagccgcaaattgacacaactgcacttgacttggat
aatgaagttaaacaacaaccaccggcagcgcaccaattaacgcctgccttggtggcttct
caacgaatcgatcccatgattgggatggatggtatcactccgcaaatgtttatgacgaag
gagaattaa

DBGET integrated database retrieval system