KEGG   Lactobacillus casei BD-II: LCBD_1515Help
Entry
LCBD_1515         CDS       T01955                                 

Definition
(GenBank) Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00010  Glycolysis / Gluconeogenesis
lcs00020  Citrate cycle (TCA cycle)
lcs00620  Pyruvate metabolism
lcs01100  Metabolic pathways
lcs01110  Biosynthesis of secondary metabolites
lcs01120  Microbial metabolism in diverse environments
lcs01130  Biosynthesis of antibiotics
lcs01200  Carbon metabolism
Module
lcs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCBD_1515
   00020 Citrate cycle (TCA cycle)
    LCBD_1515
   00620 Pyruvate metabolism
    LCBD_1515
Enzymes [BR:lcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LCBD_1515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H DUF1780
Motif
Other DBs
NCBI-ProteinID: AEA57012
UniProt: A0A125U801
Position
1455830..1457494
Genome map
AA seq 554 aa AA seqDB search
MAFEFKLPELGEGLAEGEIVKWDVKPGDDIKEDDTLLEVQSDKSVEEIPSPVSGKILKIL
VPEGETASVGDLLVEIDDGSGPAAAPAAPATATAAPATPAPATPAVQPAPAQSVYQFKLP
ELGEGLAEGEIVKWSVKPGDQIKEDDTLLEVQSDKSVEEIPSPVAGTVVKILVPEGETAT
VGEALVDIDAPGHNDTSVATEAGAAPQPVAATPAATPAAPAAGGVPAITDPNREILAMPS
VRQYAREQGIDISQVPATGKHGRITKADVDAFKTGAPAASAQPAAPAAQAQPQPATAKPA
APAAPKPQAVAPYVSSDNEAELETREKMTPTRKAIAKAMLASKQRSPHVTSFDDVEVSKL
MAHRKKYKQYAADKGIKLTFLPYIVKALVTVLREYPEFNASIDDTTDEIVYKHYFNIGIA
TNTDHGLYVPVIKNADAKSMFEIAKEISENAQKAYDSKLKPDEMRGGSMTISNVGSIGGG
WFTPVINQPEVAILGVGKIAKEPYVNEDNEIVVGNMLKLSLSYDHRLIDGALAQTALNLM
DKLLADPDLLLMEG
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattcaaactgccagaacttggcgaaggtttggcagaaggcgaaatcgtt
aagtgggacgtcaaacctggtgatgacatcaaggaagacgataccttacttgaggttcaa
agtgataaaagtgttgaagagattccatccccggtctccggcaaaattttaaaaattctt
gttccagaaggggaaaccgcgtcagttggtgatttattggttgaaatcgatgatggctcc
ggaccggcagctgcaccggctgcacctgcgactgcaacagcagcccctgcgacacccgct
ccagcaacgcctgctgtgcaacctgcacctgcgcaatcggtttatcagtttaagttaccc
gaactaggcgaaggtttggcagaaggcgaaattgttaaatggtcagtcaagcctggcgat
caaatcaaagaggacgacacgctgttagaagttcaaagcgacaagagtgtcgaagaaatt
ccttctccagttgccggaacggttgttaagattctggtaccagaaggcgaaaccgcgaca
gtcggtgaagcgctggttgatattgatgcaccgggtcataatgacacatcggttgctact
gaggctggcgctgcaccgcagccggttgctgcaacaccggctgcgacgccagctgcacca
gcagcgggtggcgtgccggccatcaccgatccgaaccgggaaattttagcaatgccatct
gtgcgtcagtatgcacgcgaacagggcattgacatctcacaagtgccagcaaccggcaaa
catggccgaattaccaaggctgatgtcgatgcattcaagacgggcgcaccagctgcatct
gcacagccagcagcccctgctgctcaggcacaaccgcaaccagccacagcaaagccagct
gcaccggcagcaccaaagccgcaagcagttgcaccatacgtttcgagtgataatgaagct
gaacttgaaacccgtgaaaagatgaccccaactcggaaagcgattgctaaggcgatgctt
gcttctaagcaacgtagcccgcatgtgacgagttttgatgacgttgaagtttctaagtta
atggctcatcgcaagaagtacaagcaatacgcagctgataaaggtatcaagttaaccttc
ctgccgtatatcgtcaaagcacttgtgacggtgttgcgtgaatatccagaattcaatgcg
tccattgatgatacaacggatgaaattgtctataagcattacttcaacattgggattgca
acgaatacggatcacggcttgtatgtgcctgtgatcaagaatgccgatgcaaagagtatg
tttgaaattgctaaggaaattagtgaaaatgcccagaaggcttatgacagcaaactaaag
ccggatgaaatgcgcggtggctccatgaccatcagtaacgttgggtcaattggcggcggc
tggttcaccccagtgatcaatcaacctgaagttgcgattctcggagtgggtaaaattgct
aaggaaccttatgtcaacgaagacaacgaaattgtggttggcaacatgttgaaattaagt
ttgagctatgaccatcgtttgattgacggcgcgttagcacaaaccgccttgaatctgatg
gataaattgttggcagatcctgatctgctgttgatggagggataa

DBGET integrated database retrieval system