KEGG   Lactobacillus casei BD-II: LCBD_1515Help
Entry
LCBD_1515         CDS       T01955                                 

Definition
Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCBD_1515
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCBD_1515
   00020 Citrate cycle (TCA cycle)
    LCBD_1515
   00620 Pyruvate metabolism
    LCBD_1515
Enzymes [BR:lcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LCBD_1515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1455830..1457494
Genome map
AA seq 554 aa AA seqDB search
MAFEFKLPELGEGLAEGEIVKWDVKPGDDIKEDDTLLEVQSDKSVEEIPSPVSGKILKIL
VPEGETASVGDLLVEIDDGSGPAAAPAAPATATAAPATPAPATPAVQPAPAQSVYQFKLP
ELGEGLAEGEIVKWSVKPGDQIKEDDTLLEVQSDKSVEEIPSPVAGTVVKILVPEGETAT
VGEALVDIDAPGHNDTSVATEAGAAPQPVAATPAATPAAPAAGGVPAITDPNREILAMPS
VRQYAREQGIDISQVPATGKHGRITKADVDAFKTGAPAASAQPAAPAAQAQPQPATAKPA
APAAPKPQAVAPYVSSDNEAELETREKMTPTRKAIAKAMLASKQRSPHVTSFDDVEVSKL
MAHRKKYKQYAADKGIKLTFLPYIVKALVTVLREYPEFNASIDDTTDEIVYKHYFNIGIA
TNTDHGLYVPVIKNADAKSMFEIAKEISENAQKAYDSKLKPDEMRGGSMTISNVGSIGGG
WFTPVINQPEVAILGVGKIAKEPYVNEDNEIVVGNMLKLSLSYDHRLIDGALAQTALNLM
DKLLADPDLLLMEG
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattcaaactgccagaacttggcgaaggtttggcagaaggcgaaatcgtt
aagtgggacgtcaaacctggtgatgacatcaaggaagacgataccttacttgaggttcaa
agtgataaaagtgttgaagagattccatccccggtctccggcaaaattttaaaaattctt
gttccagaaggggaaaccgcgtcagttggtgatttattggttgaaatcgatgatggctcc
ggaccggcagctgcaccggctgcacctgcgactgcaacagcagcccctgcgacacccgct
ccagcaacgcctgctgtgcaacctgcacctgcgcaatcggtttatcagtttaagttaccc
gaactaggcgaaggtttggcagaaggcgaaattgttaaatggtcagtcaagcctggcgat
caaatcaaagaggacgacacgctgttagaagttcaaagcgacaagagtgtcgaagaaatt
ccttctccagttgccggaacggttgttaagattctggtaccagaaggcgaaaccgcgaca
gtcggtgaagcgctggttgatattgatgcaccgggtcataatgacacatcggttgctact
gaggctggcgctgcaccgcagccggttgctgcaacaccggctgcgacgccagctgcacca
gcagcgggtggcgtgccggccatcaccgatccgaaccgggaaattttagcaatgccatct
gtgcgtcagtatgcacgcgaacagggcattgacatctcacaagtgccagcaaccggcaaa
catggccgaattaccaaggctgatgtcgatgcattcaagacgggcgcaccagctgcatct
gcacagccagcagcccctgctgctcaggcacaaccgcaaccagccacagcaaagccagct
gcaccggcagcaccaaagccgcaagcagttgcaccatacgtttcgagtgataatgaagct
gaacttgaaacccgtgaaaagatgaccccaactcggaaagcgattgctaaggcgatgctt
gcttctaagcaacgtagcccgcatgtgacgagttttgatgacgttgaagtttctaagtta
atggctcatcgcaagaagtacaagcaatacgcagctgataaaggtatcaagttaaccttc
ctgccgtatatcgtcaaagcacttgtgacggtgttgcgtgaatatccagaattcaatgcg
tccattgatgatacaacggatgaaattgtctataagcattacttcaacattgggattgca
acgaatacggatcacggcttgtatgtgcctgtgatcaagaatgccgatgcaaagagtatg
tttgaaattgctaaggaaattagtgaaaatgcccagaaggcttatgacagcaaactaaag
ccggatgaaatgcgcggtggctccatgaccatcagtaacgttgggtcaattggcggcggc
tggttcaccccagtgatcaatcaacctgaagttgcgattctcggagtgggtaaaattgct
aaggaaccttatgtcaacgaagacaacgaaattgtggttggcaacatgttgaaattaagt
ttgagctatgaccatcgtttgattgacggcgcgttagcacaaaccgccttgaatctgatg
gataaattgttggcagatcctgatctgctgttgatggagggataa

DBGET integrated database retrieval system