KEGG   Lactobacillus casei BD-II: LCBD_1563Help
Entry
LCBD_1563         CDS       T01955                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCBD_1563 (pfkA)
   01230 Biosynthesis of amino acids
    LCBD_1563 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCBD_1563 (pfkA)
   00030 Pentose phosphate pathway
    LCBD_1563 (pfkA)
   00051 Fructose and mannose metabolism
    LCBD_1563 (pfkA)
   00052 Galactose metabolism
    LCBD_1563 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LCBD_1563 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LCBD_1563 (pfkA)
Enzymes [BR:lcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LCBD_1563 (pfkA)
Protein phosphatases and associated proteins [BR:lcs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LCBD_1563 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511849..1512808
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMNESTVGDK
IQRGGTMLYSARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTI
GLPGTIDNDIPYTDFTIGFDTAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWS
GVAGGAEDVIIPEHDFDVKKIASKLQSSRERGQKHAVILLAEGVMHADQFAKELAAHGDF
QLRSTVLGHIVRGGAPSARDRVLASQMGSYAVELLLQGKGALAVGIENNKITAHDVRTLF
DAKHHAELSLYTLAEELTF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttgaccagtggcggggatgcgcctggcatgaacgccgcggtc
cgcgctgttgctcgcaaggcgatgcacgaaggccttgaagtatatggcatcaattatgga
tttgctgggttagttgccggcgacattttcaaaatgaatgaatcaactgtcggtgataag
attcaacgcggcgggaccatgttatattccgcacgttatccacaatttgcgcaagaagaa
ggccagttgcgcggggtcgaacaattaaacaagtttggcatcgaggcgttggtcgtcatc
ggcggagacggctcttatcacggtgcactagctttgacgcgtcacggtttcaacaccatt
ggcctgccaggaacgatcgacaacgatattccttacacggacttcacgattggctttgat
actgccgttaatacagttgtggaagctgttgaccgtcttcgcgataccgcggcttcgcat
gaacgaacctttgtcattgaagtcatgggtcgtgaagctggggacattgccctttggtcg
ggcgtcgccggtggtgccgaggatgtcatcattccagaacacgactttgacgttaagaaa
attgcgtcgaagttgcaaagttctcgtgaacgtggtcaaaagcatgcggtcattcttttg
gcagaaggcgtgatgcacgctgatcaatttgccaaggaattagccgcacatggcgatttc
caattacgttcgacagttctgggacacattgttcgtggcggtgcaccgtccgcacgtgat
cgcgttttggcttcacaaatgggttcatacgcggttgaacttttgttgcaaggcaaaggc
gctttggctgtcggcattgaaaacaacaagatcacggcacatgatgttcggaccttgttt
gatgccaagcatcacgcagaactttcgctctacaccttagcggaagagttaacattttaa

DBGET integrated database retrieval system