KEGG   Lactobacillus casei BD-II: LCBD_1587Help
Entry
LCBD_1587         CDS       T01955                                 

Gene name
folA
Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lcs  Lactobacillus casei BD-II
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LCBD_1587 (folA)
   00670 One carbon pool by folate
    LCBD_1587 (folA)
Enzymes [BR:lcs01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LCBD_1587 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1535644..1536135
Genome map
AA seq 163 aa AA seqDB search
MVAFLWAQDRDGVIGKDGHLPWHLPDDLHYFRTQTEGKMMVVGRRTYESFPKRPLPDRTN
VVLTHQADYQAPGAIVLHQVAEVLDYAKEHADQALVIAGGAQIFSAFKDMVDTLLVTRLA
GSFAGDTKMIPLDWDAFTKTSSRTVEDQNPALTHTYEVWQKQK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggtagcatttttgtgggcgcaggatcgggatggtgtaatcggtaaagacggccatttg
ccatggcatttgccagatgatttgcattatttccggactcagactgaaggaaaaatgatg
gtggttgggcgtcgcacgtacgaaagttttccaaaacggccattaccagatcgtacgaac
gtggttttgacgcaccaggctgattaccaggcaccaggcgcgattgtcttgcatcaggtt
gctgaagtgcttgattatgcgaaggaacatgcagatcaggcattagtcatcgccggtggt
gctcaaatctttagcgcctttaaagacatggttgataccttgctcgtgacccgtctagct
ggcagttttgcaggtgacactaaaatgattccactagattgggatgcgtttactaaaacc
tcaagccgaactgtcgaagatcaaaaccccgctttgacgcatacttatgaagtttggcaa
aagcaaaaatga

DBGET integrated database retrieval system