KEGG   Lactobacillus casei BD-II: LCBD_1897Help
Entry
LCBD_1897         CDS       T01955                                 

Definition
(GenBank) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00010  Glycolysis / Gluconeogenesis
lcs00260  Glycine, serine and threonine metabolism
lcs00680  Methane metabolism
lcs01100  Metabolic pathways
lcs01110  Biosynthesis of secondary metabolites
lcs01120  Microbial metabolism in diverse environments
lcs01130  Biosynthesis of antibiotics
lcs01200  Carbon metabolism
lcs01230  Biosynthesis of amino acids
Module
lcs_M00002  Glycolysis, core module involving three-carbon compounds
lcs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCBD_1897
  Energy metabolism
   00680 Methane metabolism
    LCBD_1897
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCBD_1897
Enzymes [BR:lcs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCBD_1897
Membrane trafficking [BR:lcs04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LCBD_1897
Exosome [BR:lcs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCBD_1897
  Exosomal proteins of melanoma cells
   LCBD_1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEA57393
UniProt: A0A125UBC2
Position
1848370..1848939
Genome map
AA seq 189 aa AA seqDB search
MATIDLVRHAEPDITIHDDFLRPLTSAGQRQTQQLVDSLHQYPYTAFFSSPLKRAVDTIT
PIADDHGLPVQKNELLVERKMPAWLPNFSDYVNQQWQDLTFFEKPGESIHQVQERYLSFL
YGLPSSAFVAVGSHGTAISSLVEAAIPGIGYHFFSKLGYAAVTRIEMHAGNMVHLTVWEQ
KSKTFNVLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaattgacttagtgaggcatgctgaaccagacatcacgattcatgatgatttt
ttgcggccactgaccagcgctggtcagcggcaaactcagcagttggttgacagtttgcat
caatatccgtacacggcctttttttcaagcccactcaaacgtgccgttgatacgatcaca
ccgattgcagatgatcacggcttacccgttcaaaaaaacgaactattggtggagcgaaag
atgcctgcatggctgccaaatttttctgactatgttaatcagcagtggcaagatttaaca
ttctttgaaaaacctggtgaatctattcatcaagttcaagaacgttacctttcattttta
tatggactgccaagttcggcattcgtcgctgtcggtagtcatggcacggcgataagcagt
cttgtcgaagcggccatccccggtataggctatcattttttctcgaaacttggttacgcc
gctgtcacccgtatcgaaatgcatgcaggcaatatggttcacctaactgtctgggaacaa
aaatcaaagacatttaacgttctaaaatag

DBGET integrated database retrieval system