KEGG   Lactobacillus casei BD-II: LCBD_1897Help
Entry
LCBD_1897         CDS       T01955                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCBD_1897
   01230 Biosynthesis of amino acids
    LCBD_1897
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCBD_1897
  Energy metabolism
   00680 Methane metabolism
    LCBD_1897
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCBD_1897
Enzymes [BR:lcs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCBD_1897
Exosome [BR:lcs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCBD_1897
  Exosomal proteins of melanoma cells
   LCBD_1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1848370..1848939
Genome map
AA seq 189 aa AA seqDB search
MATIDLVRHAEPDITIHDDFLRPLTSAGQRQTQQLVDSLHQYPYTAFFSSPLKRAVDTIT
PIADDHGLPVQKNELLVERKMPAWLPNFSDYVNQQWQDLTFFEKPGESIHQVQERYLSFL
YGLPSSAFVAVGSHGTAISSLVEAAIPGIGYHFFSKLGYAAVTRIEMHAGNMVHLTVWEQ
KSKTFNVLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaattgacttagtgaggcatgctgaaccagacatcacgattcatgatgatttt
ttgcggccactgaccagcgctggtcagcggcaaactcagcagttggttgacagtttgcat
caatatccgtacacggcctttttttcaagcccactcaaacgtgccgttgatacgatcaca
ccgattgcagatgatcacggcttacccgttcaaaaaaacgaactattggtggagcgaaag
atgcctgcatggctgccaaatttttctgactatgttaatcagcagtggcaagatttaaca
ttctttgaaaaacctggtgaatctattcatcaagttcaagaacgttacctttcattttta
tatggactgccaagttcggcattcgtcgctgtcggtagtcatggcacggcgataagcagt
cttgtcgaagcggccatccccggtataggctatcattttttctcgaaacttggttacgcc
gctgtcacccgtatcgaaatgcatgcaggcaatatggttcacctaactgtctgggaacaa
aaatcaaagacatttaacgttctaaaatag

DBGET integrated database retrieval system