KEGG   Lactobacillus casei BD-II: LCBD_1974Help
Entry
LCBD_1974         CDS       T01955                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lcs00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1925723..1927159)
Genome map
AA seq 478 aa AA seqDB search
MTAFPKGFLWGGAVAAHQFEGGWQAGGKGVSIADVMTAGDNETKRRITDGVQSGENYPNH
DAIDYYHRYHEDDQLFADLGLNCFRTSIAWTRIFPNGDEEQPNEAGLKFYDDVFDDLLSH
QIEPVITLSHFEIPYHLVKKYGGWRSRKVIDFFVKFATVVFDRYKDKVKYWMTFNEINNQ
VGMMNEWSLFTNSGLLIKPDEDKEAVMFQAAHYEAVASALAVQIGHRINPDFQIGCMVAM
GPVYPATPNPNDVFKAERTMQTNYYLADVQVKGKYPAFLDRYFDRHAFNLDITLEDRDVL
LAGKVDYIGFSYYASHVTEASQDEPTDFITMGHNREVKNSTLQRSDWGWEIDPVGLRYAL
NWFSDRYEVPLFIVENGFGAFDKINQDGHIQDDYRIDYLRQHINQMRLAVEVDGVKLMGY
TPWGIIDLVSAGTGQMEKRYGVIYVDKDDQGKGTLARSKKASFDWFQKVIRSNGDDLA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
ttgacagcatttcctaaaggtttcttgtggggcggcgcagtcgctgctcatcaattcgaa
ggtgggtggcaagcaggcggtaaaggggtcagtattgctgatgtgatgaccgcaggcgat
aatgaaactaaacgcagaatcacagacggtgttcaatcaggcgagaattatcccaatcat
gatgctattgattattatcatcgctatcatgaagatgatcagctctttgctgatttaggc
ttgaactgttttcggacaagcatagcttggactagaattttcccgaatggtgatgaagaa
cagccgaacgaagcaggactgaaattttatgatgacgtgtttgatgatcttttatcacat
cagattgaaccagtgattaccttgtcacattttgaaataccttatcaccttgtcaaaaaa
tatggtggttggcgtagtcgtaaggtgattgatttcttcgtcaaatttgcgactgttgtg
tttgatcggtacaaagacaaagttaaatattggatgacttttaacgaaatcaataatcag
gttggcatgatgaatgaatggtctctgttcaccaattctgggctactgatcaagcctgat
gaagataaagaagcagtcatgtttcaagcagctcattatgaggccgttgcaagtgccttg
gcagtccaaattgggcatcggattaaccccgattttcaaattggctgtatggttgcgatg
ggtcctgtttatcccgcaacaccgaatccaaatgatgtgtttaaagctgagcgaacgatg
cagactaattattatctggcagatgtccaagtaaagggcaagtatcctgcatttttggat
cgttattttgatcgacatgcgtttaacttggacatcacacttgaagatcgtgatgtttta
ttagctgggaaagtcgattatattggattttcttactatgcttcccatgtcactgaagcc
tcacaagatgaacctacagactttattaccatgggacacaatcgagaggttaagaattcg
acgcttcaacgttcagactggggttgggagattgatccagtcgggttgcgttatgcactc
aactggtttagtgatcgatatgaggtacccttgtttattgtcgaaaacggttttggggca
tttgataagatcaatcaggatggccatattcaagacgactatcgaatcgattatttacgt
caacatattaatcagatgcgacttgcggttgaggtcgatggtgtcaagctgatgggttat
acaccgtggggcattattgatttggtttcggcgggaaccggtcaaatggaaaaacgttat
ggcgtgatttatgttgataaagatgatcaaggtaaaggcacacttgcacgaagcaaaaaa
gcctcttttgattggttccaaaaagttattcgtagtaacggggatgatctcgcctag

DBGET integrated database retrieval system