KEGG   Lactobacillus casei BD-II: LCBD_2167Help
Entry
LCBD_2167         CDS       T01955                                 

Gene name
pyrF2
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LCBD_2167 (pyrF2)
Enzymes [BR:lcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LCBD_2167 (pyrF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2113504..2114106)
Genome map
AA seq 200 aa AA seqDB search
MKAAHKLIVITGATGTGKTTVSGYLRDNYRIHRVMTHTTRPARTGEKNGVDYYFETPASF
ATKHFIEKVTYAGYEYGSSHESLEKNWTKHPFLSIVLDTKGAITYVRELPKEVVVLFLTI
DNPTVLKDRLLSRGDDPAMVAARLKSPEYKRDLTLPDELKPFATVIKNDSWDEAREQVDQ
FMKTLALKSCGLARIDLEQK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgcataagttgattgtgatcactggggcaacagggactggcaaaacgacg
gtgagtggttatcttcgcgataattatcgcatccaccgcgtgatgacgcacaccacccgt
ccggcgcgcacaggggaaaagaatggggtcgattactatttcgaaacaccggcgagtttt
gcgaccaaacattttatcgaaaaagtcacttatgctggttatgagtacggttcctcccat
gaatcgcttgaaaaaaactggactaagcatcccttccttagtattgttctagacacaaaa
ggtgccattacctatgtgcgtgagttgccaaaggaggtcgtggtcttatttttaacaatt
gataacccaacggtattaaaagatcggttgttgagccgtggtgatgatcctgccatggtt
gctgcgcggttgaaaagtccggaatataagcgcgatttaaccttgccagacgaactaaag
ccgtttgccactgtgatcaaaaatgacagttgggatgaggcgcgcgagcaagtggatcaa
tttatgaaaaccttggctttgaaaagttgcggccttgcccgcatcgatttagaacaaaaa
taa

DBGET integrated database retrieval system