KEGG   Lactobacillus casei BD-II: LCBD_2167Help
Entry
LCBD_2167         CDS       T01955                                 

Gene name
pyrF2
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00230  Purine metabolism
lcs01100  Metabolic pathways
Module
lcs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LCBD_2167 (pyrF2)
Enzymes [BR:lcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LCBD_2167 (pyrF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 T2SSE AAA_28 ABC_tran AAA_30 CoaE AAA_16 SRP54 AAA_23 AAA_33 ResIII DUF3391 NTPase_1 AAA_19 AAA_25
Motif
Other DBs
NCBI-ProteinID: AEA57663
UniProt: A0A125UC40
Position
complement(2113504..2114106)
Genome map
AA seq 200 aa AA seqDB search
MKAAHKLIVITGATGTGKTTVSGYLRDNYRIHRVMTHTTRPARTGEKNGVDYYFETPASF
ATKHFIEKVTYAGYEYGSSHESLEKNWTKHPFLSIVLDTKGAITYVRELPKEVVVLFLTI
DNPTVLKDRLLSRGDDPAMVAARLKSPEYKRDLTLPDELKPFATVIKNDSWDEAREQVDQ
FMKTLALKSCGLARIDLEQK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgcataagttgattgtgatcactggggcaacagggactggcaaaacgacg
gtgagtggttatcttcgcgataattatcgcatccaccgcgtgatgacgcacaccacccgt
ccggcgcgcacaggggaaaagaatggggtcgattactatttcgaaacaccggcgagtttt
gcgaccaaacattttatcgaaaaagtcacttatgctggttatgagtacggttcctcccat
gaatcgcttgaaaaaaactggactaagcatcccttccttagtattgttctagacacaaaa
ggtgccattacctatgtgcgtgagttgccaaaggaggtcgtggtcttatttttaacaatt
gataacccaacggtattaaaagatcggttgttgagccgtggtgatgatcctgccatggtt
gctgcgcggttgaaaagtccggaatataagcgcgatttaaccttgccagacgaactaaag
ccgtttgccactgtgatcaaaaatgacagttgggatgaggcgcgcgagcaagtggatcaa
tttatgaaaaccttggctttgaaaagttgcggccttgcccgcatcgatttagaacaaaaa
taa

DBGET integrated database retrieval system