KEGG   Lactobacillus casei BD-II: LCBD_2186Help
Entry
LCBD_2186         CDS       T01955                                 

Definition
Fructose-1-6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCBD_2186
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCBD_2186
   00030 Pentose phosphate pathway
    LCBD_2186
   00051 Fructose and mannose metabolism
    LCBD_2186
  Energy metabolism
   00680 Methane metabolism
    LCBD_2186
Enzymes [BR:lcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LCBD_2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2135803..2137734)
Genome map
AA seq 643 aa AA seqDB search
MDLYSELTAKYQTVPAIATEIINLEAILNLPKPTEAFMSDIHGEYNAFQHVLRNGSGNVK
SKIRSCFRDEMTEATLQRFAFLVYYPSERMAAIHREMAGDDLQQWYLTTFRRLIRLLAFT
ATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIRNLIVLEQADQWIAATCQ
TIQRLTVDHFHVVGDIYDRGPAPDQVVESLIRRDRRHSVDIQWGNHDILWIGAAAGSALC
IANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQDNPAFSPKMERSDRPITEAERLQ
ITQIHQAIAMIQFKLEGPVIKRRPEFDMDHRLVLEKLAPDFSTIKLNGDTYTIENGCFAT
VDPADPYKLLPEEQEVIDSLVESFTHSEKLHRHMDFLLDHGSMYLRYNRNLLLHGCVPVD
EDGNFIGLTIKGTTYTGRQLFDMLEANLRLAYSQPTENADLATDLMWYLWTGPNSPLFGK
HDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIKKILAEFVLDPEVGHVINGHTPVKKG
TDPIMANNKMIVIDGGFSKPYQKTTGIGGYTLLDNSYGMQLVTHQPFTTKADAIANLTDI
ISTRRVVETEARRRTVAETDIGTELQDEVEVLKRRLGELREEE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagtgaactgacggcgaagtatcaaacggtgccagcgattgcgactgaa
atcattaatctggaagccattttgaatttacctaagccgacggaagcgtttatgagcgat
atccacggggagtataacgcctttcagcatgttttgcggaacggcagcgggaatgtgaaa
agcaaaattcgttcctgttttcgcgatgaaatgacggaggcgaccctgcagcgcttcgct
tttttggtgtactatccgtctgagcgaatggcggcgattcatcgggagatggcaggggat
gacttgcaacagtggtatttgacgacttttcgccggttgattcgcttgctggcgttcacc
gcgaccaaatacacgcgttcgaaagttcgcaaggcgatggcaccggagtttgtctatatc
accgaagagttgctgtacaatgatgccgatacgcctgacaagctggcttattattggcaa
attattcgtaatttaatcgttcttgaacaggccgatcagtggattgcggcaacgtgtcaa
acgattcaacgtttaacggtagatcattttcacgttgtaggcgatatctatgatcgagga
ccggcgccggatcaggtggttgaaagcttgattagacgtgatcggcgtcattcagtggat
attcaatggggcaaccatgatattctttggatcggcgccgccgcgggctcggctttgtgc
attgccaatttggtgcggatttccgcgcggtataacaatttaagtattctcgaagatgtt
tatgggattaatttgcggcatttggcccgattagcggaacaatactatcaagataatccc
gccttttcaccaaaaatggagcggtcagatcgaccaataactgaggcggagcgacttcaa
attacgcagattcatcaggcgattgcgatgattcaatttaagttggaaggaccagtgatt
aaacgtcggcctgaatttgacatggatcatcggctagtgctggagaaactggcacctgat
ttttcaaccatcaagttgaatggtgatacttatacgattgaaaacggctgttttgcgacg
gttgatccggctgatccttacaagttgttgccagaggagcaagaggtcattgactcgctg
gttgagtcctttacgcactctgaaaagttgcatcgccacatggattttctacttgatcac
ggcagtatgtatttgcggtacaaccggaatttgttgctgcacgggtgtgtgccggtggac
gaggatggcaattttattggcttgaccattaaagggacgacttatactggccgtcaacta
tttgacatgctggaagcaaatcttcggttggcatacagtcaaccaacggagaatgctgac
ttagcaaccgatctgatgtggtatctctggaccggtccaaattcaccgctttttggcaag
cacgacatgacgacctttgaacgctatttcattagcgatccgaaagcccatgtcgaaggc
cgtaatccgtattatcacctgcgtaaggacccggaatttatcaaaaagatcttggcggaa
tttgtcctcgatcctgaagtcggccatgtcattaatggtcatacgccagtcaaaaaaggc
accgaccccattatggcaaacaacaaaatgatcgtcatcgacggcggcttttctaaaccg
tatcaaaaaaccaccgggatcggcggttacacgcttttggataattcttatggtatgcaa
ctagtgacgcaccaaccattcaccacaaaagccgatgctatcgccaaccttactgatatc
atttcaacccgtcgcgtcgtcgaaaccgaagcccgccgccgaacggtagcagaaactgac
attggcactgagctacaggatgaggttgaggtgttgaagcggcgattgggtgagttgcgg
gaagaagaatag

DBGET integrated database retrieval system