KEGG   Lactobacillus casei BD-II: LCBD_2186Help
Entry
LCBD_2186         CDS       T01955                                 

Definition
(GenBank) Fructose-1-6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00010  Glycolysis / Gluconeogenesis
lcs00030  Pentose phosphate pathway
lcs00051  Fructose and mannose metabolism
lcs00680  Methane metabolism
lcs01100  Metabolic pathways
lcs01110  Biosynthesis of secondary metabolites
lcs01120  Microbial metabolism in diverse environments
lcs01130  Biosynthesis of antibiotics
lcs01200  Carbon metabolism
Module
lcs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCBD_2186
   00030 Pentose phosphate pathway
    LCBD_2186
   00051 Fructose and mannose metabolism
    LCBD_2186
  Energy metabolism
   00680 Methane metabolism
    LCBD_2186
Enzymes [BR:lcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LCBD_2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AEA57682
UniProt: A0A125U9Y6
Position
complement(2135803..2137734)
Genome map
AA seq 643 aa AA seqDB search
MDLYSELTAKYQTVPAIATEIINLEAILNLPKPTEAFMSDIHGEYNAFQHVLRNGSGNVK
SKIRSCFRDEMTEATLQRFAFLVYYPSERMAAIHREMAGDDLQQWYLTTFRRLIRLLAFT
ATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIRNLIVLEQADQWIAATCQ
TIQRLTVDHFHVVGDIYDRGPAPDQVVESLIRRDRRHSVDIQWGNHDILWIGAAAGSALC
IANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQDNPAFSPKMERSDRPITEAERLQ
ITQIHQAIAMIQFKLEGPVIKRRPEFDMDHRLVLEKLAPDFSTIKLNGDTYTIENGCFAT
VDPADPYKLLPEEQEVIDSLVESFTHSEKLHRHMDFLLDHGSMYLRYNRNLLLHGCVPVD
EDGNFIGLTIKGTTYTGRQLFDMLEANLRLAYSQPTENADLATDLMWYLWTGPNSPLFGK
HDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIKKILAEFVLDPEVGHVINGHTPVKKG
TDPIMANNKMIVIDGGFSKPYQKTTGIGGYTLLDNSYGMQLVTHQPFTTKADAIANLTDI
ISTRRVVETEARRRTVAETDIGTELQDEVEVLKRRLGELREEE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagtgaactgacggcgaagtatcaaacggtgccagcgattgcgactgaa
atcattaatctggaagccattttgaatttacctaagccgacggaagcgtttatgagcgat
atccacggggagtataacgcctttcagcatgttttgcggaacggcagcgggaatgtgaaa
agcaaaattcgttcctgttttcgcgatgaaatgacggaggcgaccctgcagcgcttcgct
tttttggtgtactatccgtctgagcgaatggcggcgattcatcgggagatggcaggggat
gacttgcaacagtggtatttgacgacttttcgccggttgattcgcttgctggcgttcacc
gcgaccaaatacacgcgttcgaaagttcgcaaggcgatggcaccggagtttgtctatatc
accgaagagttgctgtacaatgatgccgatacgcctgacaagctggcttattattggcaa
attattcgtaatttaatcgttcttgaacaggccgatcagtggattgcggcaacgtgtcaa
acgattcaacgtttaacggtagatcattttcacgttgtaggcgatatctatgatcgagga
ccggcgccggatcaggtggttgaaagcttgattagacgtgatcggcgtcattcagtggat
attcaatggggcaaccatgatattctttggatcggcgccgccgcgggctcggctttgtgc
attgccaatttggtgcggatttccgcgcggtataacaatttaagtattctcgaagatgtt
tatgggattaatttgcggcatttggcccgattagcggaacaatactatcaagataatccc
gccttttcaccaaaaatggagcggtcagatcgaccaataactgaggcggagcgacttcaa
attacgcagattcatcaggcgattgcgatgattcaatttaagttggaaggaccagtgatt
aaacgtcggcctgaatttgacatggatcatcggctagtgctggagaaactggcacctgat
ttttcaaccatcaagttgaatggtgatacttatacgattgaaaacggctgttttgcgacg
gttgatccggctgatccttacaagttgttgccagaggagcaagaggtcattgactcgctg
gttgagtcctttacgcactctgaaaagttgcatcgccacatggattttctacttgatcac
ggcagtatgtatttgcggtacaaccggaatttgttgctgcacgggtgtgtgccggtggac
gaggatggcaattttattggcttgaccattaaagggacgacttatactggccgtcaacta
tttgacatgctggaagcaaatcttcggttggcatacagtcaaccaacggagaatgctgac
ttagcaaccgatctgatgtggtatctctggaccggtccaaattcaccgctttttggcaag
cacgacatgacgacctttgaacgctatttcattagcgatccgaaagcccatgtcgaaggc
cgtaatccgtattatcacctgcgtaaggacccggaatttatcaaaaagatcttggcggaa
tttgtcctcgatcctgaagtcggccatgtcattaatggtcatacgccagtcaaaaaaggc
accgaccccattatggcaaacaacaaaatgatcgtcatcgacggcggcttttctaaaccg
tatcaaaaaaccaccgggatcggcggttacacgcttttggataattcttatggtatgcaa
ctagtgacgcaccaaccattcaccacaaaagccgatgctatcgccaaccttactgatatc
atttcaacccgtcgcgtcgtcgaaaccgaagcccgccgccgaacggtagcagaaactgac
attggcactgagctacaggatgaggttgaggtgttgaagcggcgattgggtgagttgcgg
gaagaagaatag

DBGET integrated database retrieval system