KEGG   Lactobacillus casei BD-II: LCBD_2237Help
Entry
LCBD_2237         CDS       T01955                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lcs00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lcs00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2188200..2190422
Genome map
AA seq 740 aa AA seqDB search
MANIEYDPERQLFHLHNDTFSYVIQVIRGYLVKRYCGPALDHFSGTAKLEDFSHAFNIQN
DAAPYSLTTLPLEYSTLMGGDYRTPAYAVRNGHGQLIGNLKFDHYQILAGNESFNGTLPT
ARTPHGQTLIITMHDETQTLAVRLKYTIVGDLPVLLKQVEYRNLTDTTLTITHAASLQLD
FDDHAYDLITLTGAHLNEAKVTRQPLTPGKKSIGSNYGASGPQGVPATILAAPATNEFAG
EALGVTLLWSGNFNYTAQVDQFDNSRLVMGLNPELFAWQLKPGKPFVTPEAAVAYTNDGL
NDLSRIFHRFFADHVMPLPRKNLIEYNTWETTYFDVSEAKILAEIPKAEELGVELLVIDD
GWFKNRPNDAGQLGDWVPDPAKFPHGLRPVADAIHARGLAFGLWVEPEMISENSELYATH
PDWAMQYVGQKPLRSRNQLILDLSQRIVQDHLITVLTNLVRDNHIDYLKWDYNRHFSQPG
SPVLPPDQQGEVGYRYTRGLYRVLKTLRDTFPKLLIENCSSGGGRLDGGMIAYTDQTWTS
DFTDPVYRMKIMNGFSLFFPLKIFVSHFTASPNLQDARLTPLHTRALLSLVGITGIECPP
SQLSPAEAAAVKASFAFYKANRKELQNGLLFRLQPSHVNQDEVCWLITNAAKTNALVLTS
VGVTSPIPHYQHVLLHYLDPKLSYQIDKTKNATGLELNHAGVTLPLAHGDFSATLMELTA
VTNLPQTTAAPTLDQITTQS
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgaatatgatccggaacgtcaattatttcatttgcacaacgacaccttt
agctatgtcattcaagttattcgcggttatcttgttaaacgatactgcggaccggcgctg
gatcatttttccggtaccgccaaacttgaagacttcagccatgcttttaacattcaaaat
gatgccgcaccttactcactgacgaccttgccgctggaatatagcacattgatgggcggc
gattaccggacgccagcttacgccgtgcgtaacggtcacggtcagctgattggtaatctc
aagtttgaccactatcaaatccttgcaggcaatgaaagctttaacggtaccttgccgaca
gcgcggacaccgcacgggcaaacgctgatcataacgatgcacgatgaaacccagacgctt
gctgtccggctcaaatacacgattgtcggcgatttgcctgtcttgctcaaacaagttgag
tatcgtaatctgacagacacgacactgacgattactcatgctgccagccttcaactggat
tttgacgaccacgcttatgacctcattacgctgaccggtgctcatctcaatgaggccaaa
gtgacccgccagccgctgacccccggcaaaaagtcaatcggcagtaattatggcgccagt
gggccgcaaggtgtcccggcgacgattcttgcagcgccagcgaccaatgaatttgctggg
gaagctttaggcgtcacgcttttgtggagcggcaattttaactatacggcgcaagtcgat
cagttcgacaacagccggctcgtgatgggactgaatccggagctctttgcttggcagctc
aagcccggcaagccatttgtcacgccggaagcagccgtcgcttacaccaacgatggccta
aatgatctcagccggatcttccaccgcttttttgccgatcatgtcatgccattgccgcgc
aaaaacctaattgaatacaacacgtgggaaaccacttattttgacgttagcgaagccaaa
attctagccgagattcccaaagccgaagagttaggagttgagttactggtcattgatgat
ggctggttcaaaaatcggcctaacgatgctggccaacttggcgactgggtacctgatccc
gctaagtttccacatggcctgcgcccggtggctgacgcaattcacgctcgcggccttgct
tttgggctttgggtcgaacccgaaatgatcagcgaaaatagtgagctctatgccacccat
cctgactgggccatgcagtatgtcggccaaaaacctctgcgttctcgcaatcagcttatt
ctcgatctcagtcagcggattgtgcaggatcacttgatcacagttctaactaacctcgtg
cgcgataatcatattgattacctcaagtgggactataaccgccacttcagtcaacctggc
agtccggtactgccacctgatcaacaaggtgaagtcggctatcgctatacccgcggctta
tatcgggttttgaaaacgttacgcgacacttttccaaagctactcatcgaaaattgttcg
tccggcggtggccgtttagatggcgggatgatcgcctacaccgaccaaacatggaccagc
gattttactgacccggtttaccgcatgaaaattatgaacggcttctcgctgtttttcccg
ctcaaaatttttgtctcgcatttcaccgcctccccgaatctacaagatgcgcggttaacg
cccttgcatacccgcgcactgttaagtctggttggcatcactggcatcgaatgcccgccg
agtcagctcagtcccgctgaagccgcggcggtcaaggccagttttgccttttacaaagcg
aatcgcaaagaattgcagaatggtttgctttttcggttacaacctagccatgttaatcaa
gacgaggtttgttggctgatcactaacgccgccaaaaccaatgcactggtcttgacttca
gtcggtgtcacttcgccgattcctcattatcaacatgtactgctgcattacttggaccca
aaattgtcttatcaaatcgacaagacaaaaaatgccaccgggttagaacttaaccacgcc
ggtgttaccttgccacttgcccatggtgatttttcggcaacgctcatggagctgacggcg
gtaaccaaccttccgcaaaccaccgcagcaccgacgcttgatcaaataaccacgcaaagt
tag

DBGET integrated database retrieval system