KEGG   Lactobacillus casei BD-II: LCBD_2658Help
Entry
LCBD_2658         CDS       T01955                                 

Definition
cobalt ABC transporter ATP-binding protein
Orthology
K16787  
energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
lcs  Lactobacillus casei BD-II
Pathway
ABC transporters
Module
Energy-coupling factor transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:lcs02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2585711..2586577)
Genome map
AA seq 288 aa AA seqDB search
MDITFDHVSFTYQAGTPFAGDGIKDVSGVIRDGSYTAIIGHTGSGKSTILQHLNALLKPT
SGTVTIGDKVITNETNNKNLKPLRQKVGMVFQFAENQLFEQTVAKDIAFGPQNFGVNEKD
ALALADKMVKMVGLPHDVLEKSPFDLSGGQMRRVAIAGVLAMQPEVLVLDEPTAGLDPSG
RHEMMQMFEQLHREQGQTIVLVTHQMDDVADYADTVWVMAEGKLIKTGTPREIFADPAWL
KANQLGLPKTAQLAQQLAAKGFHFDPQPLTESELADQLVPQIGGGQRG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtggacattacattcgaccatgtgagctttacctatcaggcaggtacgcctttcgctggt
gatggcattaaagatgtgagcggggttattcgagacggcagctatacggcaattatcggt
cacaccggttctggcaaatcaaccattctgcaacatctgaacgcgttgttgaaaccaact
tccggcacggtgacgattggcgacaaggtcattaccaatgaaactaacaataagaacctc
aagccgctacggcaaaaagtcgggatggttttccaatttgcggaaaatcagttgtttgaa
caaacagtcgctaaggatatcgcttttggcccccaaaattttggggttaacgaaaaagat
gccttagctttggccgataaaatggtcaaaatggttggcttaccgcatgatgtgttggaa
aagtcaccgtttgatctgtctggtggtcagatgcgtcgtgttgcgattgcaggcgtgtta
gcgatgcagccggaggtattagtactggatgagccaacggcgggcctggacccctcagga
cgccatgagatgatgcaaatgtttgaacagttgcaccgcgagcaaggacaaacgatcgtg
ttggtgacacatcaaatggatgatgtggcagactatgcggatacagtttgggtcatggca
gaaggcaagttaatcaaaacaggaacaccgcgagagatttttgctgacccagcttggtta
aaagctaatcagctagggctgccaaagacggcgcaactggcgcaacaattagcagctaag
gggttccactttgatccacaaccgctaactgaaagcgagttggcagatcaattggtgccg
caaattggaggtggccagcgtggataa

DBGET integrated database retrieval system