KEGG   Lactobacillus casei BD-II: LCBD_2955Help
Entry
LCBD_2955         CDS       T01955                                 

Definition
Phosphoketolase 1
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCBD_2955
Enzymes [BR:lcs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LCBD_2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2876055..2878442
Genome map
AA seq 795 aa AA seqDB search
MDQTIEKTIDYSSKEYLNEVDKYWRAANYLSVGQLYLKDNPLLKRPLKATDVKVHPIGHW
GTIAGQNFIYAHLNRVINKYNLNMFYIEGPGHGGQVMVSNSYLDGSYTELYPKISQDEQG
LQRLFKQFSFPGGVASHADPKTPGSIHEGGELGYSILHGAGAVLDNPDLIAAVVVGDGES
ETGPLATSWQVNKFLNPITDGTVLPILNLNGFKIANPTVLARESHEELVDYFKGLGWDPH
FVEGSDPDKMHPQMAAEMDKIVEEIESIRKNAKDNNDESRPVWPMLVLRAPKGWTGPKTW
DGEPIEGSFRAHQIPIPVDQKDMEHADDLVAWLESYKPKELFNDDGTLKADIEAIIPKGS
LRMAMNPVTNGGILAKHLEKPNPSDYAVDNKDHGANEAQDMTVLGAYIRDLIKLNDKNRN
FRGFGPDETLSNRLNKVFEATNRQWMEPIHKPYDALLASHGRIIDSMLSEHMDEGMLEGY
TLTGRYGFFASYESFLRVVDSMLTQHFKWLRNAHEEADWRADVPALNVIASSTAFQQDHN
GYSHQDPGVISHLAEKKTKYIRAYLPADANTLVRVFDKSVDAKQVINLIVSSKHPRPQWF
TDSEAKSLVEKGLGIIDWASTDQGAEPDLVIAAAGSEPTLESLAAISILHKALPSLRIRF
INVVDLLKLKKDDPRGLSDEEFDMYFTKDKPVIFAYHGYDDLIKDIFFDRHNHNVRVHGY
REEGDITTPFDMRVRNKLDRFNLVKEAVLDVPEFTEKGAHLIQDMDDELQKHHDFIREEG
TDLPEVEEWKWEPLK
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaacaattgagaaaactatcgattattcctcaaaggaatatttgaatgaggtt
gataaatactggcgggctgctaactatctgtccgttgggcaactgtacctgaaggacaat
ccgttactgaagcgacccttgaaggcaactgatgtcaaagttcatccgattgggcattgg
ggcaccattgcaggtcagaatttcatttatgctcatctgaaccgggtcatcaataaatac
aacctgaatatgttttacattgaaggtccgggacatggcggccaagtcatggtctctaat
tcttatcttgatggcagttatacagagctctatccaaaaatttctcaagatgagcaagga
ttgcaacgtttattcaaacaattttcattcccgggtggcgttgcgtctcacgccgatccc
aagacgcctggatcaattcatgaaggcggtgaattgggctattccatccttcatggcgct
ggtgccgttcttgataatccggatctcattgccgcagttgttgttggtgatggtgaatct
gaaacaggtccacttgccacctcttggcaagtaaataagtttttgaacccaattacagac
ggtaccgttttgccaatcttgaacttaaatggtttcaaaatcgccaatccaacggttctt
gctcgggagtcgcacgaagagttagtggactactttaaaggtctcggttgggatccacat
tttgttgaaggatcggatcctgataagatgcatccccaaatggcagctgagatggataaa
atcgtcgaagaaattgagtctattcgtaaaaatgccaaagataacaatgacgagagtcgt
ccagtttggccaatgcttgttttacgggcaccaaagggttggacaggtcctaagacgtgg
gatggcgagccaattgaaggctccttccgtgcgcatcaaatcccgattccggtggatcaa
aaagacatggaacatgcagacgatctagtcgcttggttggaatcatacaaaccaaaggaa
cttttcaatgacgatggcaccctcaaagctgacattgaagccatcattcctaaaggcagc
cttagaatggcaatgaatcctgttaccaatggcggcattcttgccaaacatctcgaaaaa
ccaaatccgagcgattatgctgtggacaataaggatcacggtgctaatgaagcgcaggat
atgactgtgctcggcgcttatatccgggatctcatcaaattgaatgataagaacagaaac
ttccgcggatttggaccagacgaaaccttatccaatcgtttaaacaaggtttttgaagcc
accaatcggcaatggatggaaccgatccataaaccttatgatgccttactagctagccat
ggtcggattattgactcaatgctatcggaacacatggatgaaggcatgctggagggatac
acgttaactggtcgttatggtttctttgccagctacgagtccttcttacgggtggttgat
tccatgcttacccagcatttcaagtggttacggaatgcacacgaagaagctgattggcgg
gctgatgtacctgccttaaacgttatcgcctcttctactgctttccagcaagaccacaat
ggctactcgcatcaggatcccggtgtcatcagtcatctagctgaaaagaagacaaagtat
attcgcgcttatctgccagcagacgcgaacaccttggttcgtgtcttcgataaatccgtt
gatgctaaacaagtcattaatctgattgtttccagcaaacatccacgaccacaatggttc
acagattcagaggcaaagtctttggttgaaaaaggtctgggtatcattgattgggcaagc
acggatcaaggtgcagaacctgatttggttattgccgcggctggttcagaaccaacactt
gagagcttggctgccatctcaatcttgcacaaggcattgcctagtttgaggatccgcttc
atcaatgtcgttgatttgttaaaacttaagaaagacgaccctcgcggcctatcagatgaa
gagtttgatatgtactttacaaaagacaaaccggtcatctttgcttatcacggctacgat
gatctgatcaaggacattttcttcgatcgtcataatcacaacgttcgcgttcacggctat
cgtgaagaaggtgacatcacgacaccatttgatatgcgtgttcgtaacaagttggaccgc
tttaacttggtcaaagaagccgttctcgatgtccctgaattcaccgaaaaaggtgcccat
ctcattcaagatatggatgatgagcttcagaagcaccacgacttcatccgcgaggaaggt
accgatttacctgaagttgaagagtggaaatgggaaccgttaaagtag

DBGET integrated database retrieval system