KEGG   Lactobacillus casei W56: BN194_02910Help
Entry
BN194_02910       CDS       T02337                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lcw  Lactobacillus casei W56
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lcw00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lcw00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288876..290531
Genome map
AA seq 551 aa AA seqDB search
MVLSLSQPPKQVAAADNTLKSVFSIDAGRKFFSADQLKMIIDRAHTDGYTDVQVLLGNDA
LRLLLDDMSVTINGKTYGSDVVKQAIQAGNKAYYDDPNGNALTQTDMDAVLKYAAARDIN
IIPVINSPGHMDAILTAMAQLGIKNPAFNGSKRTVDLNNDTAIAFTKALLQKYVMYFKGH
ATIFNFGSDEYANDVDTGGWAKLQQSGTYKKFVAYVNDLAAMAKNASLKPMVFNDGIYYD
NNTSFGTFDKDLIVSYWTAGWGGYDVAKPEFLTDKGLKIMNTNDGWYWVLGRVDGDLYSY
KTALASLASKKFTDVPGASSAVPIIGSVQAVWADDPSAQLDMPALLKLMDQFSTAYAPYL
VRPADYSKVDAAIAAVPRQLNQYTEASVAKLDAALNAVVRGKKATDQALVDGYAQTITVA
IKALQLRPADYTKVDAAIAAAKKLDRSHYQDLSAVDAALAAVNRNLSITQQAQADTMAAK
ITAAIAALVLKPAPQPDPRQQQVPTKTIVNPDRYLPKTAEASGWELMLAGLATIFGVISI
VFFWRQHRMAV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgagtctgagtcagccgcccaagcaggtagctgctgctgataacaccttgaaa
agcgttttttcgattgatgcgggacgaaagtttttttccgcggatcagttgaaaatgatc
attgatcgggcacatacagacggttacaccgatgtgcaggttttattgggcaacgatgca
ttgcgattgctacttgatgacatgagcgtgacgatcaatggcaaaacatatggcagtgat
gtcgtgaaacaggccatacaggctggtaacaaagcgtactacgatgatccaaacgggaat
gcgttgacgcaaaccgacatggatgcggtcttgaaatatgcagcggcacgggatatcaat
atcattccggttatcaatagtcccggccatatggatgccattttgacggcgatggcgcaa
ctaggcattaagaatcctgcctttaatgggtctaaacggactgtcgatcttaacaatgac
actgctattgcctttacaaaagcgctattgcagaagtatgtgatgtatttcaaggggcat
gctacgatcttcaactttggcagtgacgagtatgcaaatgatgtcgatactggcggctgg
gccaagttgcaacaaagtggcacctacaaaaagtttgtggcatacgtcaacgacttagcg
gcgatggccaaaaatgccagcctgaagccgatggttttcaatgacgggatttattatgac
aataacaccagtttcgggacttttgacaaggatttgatcgtctcttattggaccgctggc
tggggcgggtatgatgtcgcaaagccagaatttttgaccgataagggtttgaaaatcatg
aataccaatgacggttggtattgggttttaggtcgcgtggacggcgatctctatagttac
aaaacggcgctagctagtttagcaagtaaaaaatttactgatgtacccggcgcttcgagt
gccgtgccgattattggcagtgtgcaggcggtttgggcggatgatccgagtgcacagtta
gacatgccggcgctgttgaagttgatggatcaattttcgacagcctatgcaccttactta
gttcgcccagccgattacagtaaagttgatgccgccatcgctgccgtgccgcggcaactt
aatcagtacaccgaagcatcagttgctaaacttgatgcagcgttaaatgctgttgtccgc
ggtaaaaaggcaaccgatcaggcattggttgacggctatgcccagaccattactgtcgcc
atcaaggcactgcaactgcggccggccgattacacaaaggttgatgccgccattgcagct
gcaaagaaacttgaccggtcacactatcaagaccttagtgccgttgatgcggcgcttgct
gctgttaatcgtaatctcagcatcacccagcaagcccaagctgataccatggctgccaag
attacagctgccatcgctgcgttggttctgaagccggcgccgcaacccgatccaaggcag
cagcaagtgccaacaaaaaccattgtgaatccagaccggtatttaccaaaaacggcagaa
gcttccgggtgggaattgatgctagctgggcttgccacgatttttggtgtcattagcatt
gttttcttttggcggcaacatcgcatggccgtctaa

DBGET integrated database retrieval system