KEGG   Lactobacillus casei W56: BN194_02910Help
Entry
BN194_02910       CDS       T02337                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lcw  Lactobacillus casei W56
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN194_02910
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN194_02910
Enzymes [BR:lcw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BN194_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288876..290531
Genome map
AA seq 551 aa AA seqDB search
MVLSLSQPPKQVAAADNTLKSVFSIDAGRKFFSADQLKMIIDRAHTDGYTDVQVLLGNDA
LRLLLDDMSVTINGKTYGSDVVKQAIQAGNKAYYDDPNGNALTQTDMDAVLKYAAARDIN
IIPVINSPGHMDAILTAMAQLGIKNPAFNGSKRTVDLNNDTAIAFTKALLQKYVMYFKGH
ATIFNFGSDEYANDVDTGGWAKLQQSGTYKKFVAYVNDLAAMAKNASLKPMVFNDGIYYD
NNTSFGTFDKDLIVSYWTAGWGGYDVAKPEFLTDKGLKIMNTNDGWYWVLGRVDGDLYSY
KTALASLASKKFTDVPGASSAVPIIGSVQAVWADDPSAQLDMPALLKLMDQFSTAYAPYL
VRPADYSKVDAAIAAVPRQLNQYTEASVAKLDAALNAVVRGKKATDQALVDGYAQTITVA
IKALQLRPADYTKVDAAIAAAKKLDRSHYQDLSAVDAALAAVNRNLSITQQAQADTMAAK
ITAAIAALVLKPAPQPDPRQQQVPTKTIVNPDRYLPKTAEASGWELMLAGLATIFGVISI
VFFWRQHRMAV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgagtctgagtcagccgcccaagcaggtagctgctgctgataacaccttgaaa
agcgttttttcgattgatgcgggacgaaagtttttttccgcggatcagttgaaaatgatc
attgatcgggcacatacagacggttacaccgatgtgcaggttttattgggcaacgatgca
ttgcgattgctacttgatgacatgagcgtgacgatcaatggcaaaacatatggcagtgat
gtcgtgaaacaggccatacaggctggtaacaaagcgtactacgatgatccaaacgggaat
gcgttgacgcaaaccgacatggatgcggtcttgaaatatgcagcggcacgggatatcaat
atcattccggttatcaatagtcccggccatatggatgccattttgacggcgatggcgcaa
ctaggcattaagaatcctgcctttaatgggtctaaacggactgtcgatcttaacaatgac
actgctattgcctttacaaaagcgctattgcagaagtatgtgatgtatttcaaggggcat
gctacgatcttcaactttggcagtgacgagtatgcaaatgatgtcgatactggcggctgg
gccaagttgcaacaaagtggcacctacaaaaagtttgtggcatacgtcaacgacttagcg
gcgatggccaaaaatgccagcctgaagccgatggttttcaatgacgggatttattatgac
aataacaccagtttcgggacttttgacaaggatttgatcgtctcttattggaccgctggc
tggggcgggtatgatgtcgcaaagccagaatttttgaccgataagggtttgaaaatcatg
aataccaatgacggttggtattgggttttaggtcgcgtggacggcgatctctatagttac
aaaacggcgctagctagtttagcaagtaaaaaatttactgatgtacccggcgcttcgagt
gccgtgccgattattggcagtgtgcaggcggtttgggcggatgatccgagtgcacagtta
gacatgccggcgctgttgaagttgatggatcaattttcgacagcctatgcaccttactta
gttcgcccagccgattacagtaaagttgatgccgccatcgctgccgtgccgcggcaactt
aatcagtacaccgaagcatcagttgctaaacttgatgcagcgttaaatgctgttgtccgc
ggtaaaaaggcaaccgatcaggcattggttgacggctatgcccagaccattactgtcgcc
atcaaggcactgcaactgcggccggccgattacacaaaggttgatgccgccattgcagct
gcaaagaaacttgaccggtcacactatcaagaccttagtgccgttgatgcggcgcttgct
gctgttaatcgtaatctcagcatcacccagcaagcccaagctgataccatggctgccaag
attacagctgccatcgctgcgttggttctgaagccggcgccgcaacccgatccaaggcag
cagcaagtgccaacaaaaaccattgtgaatccagaccggtatttaccaaaaacggcagaa
gcttccgggtgggaattgatgctagctgggcttgccacgatttttggtgtcattagcatt
gttttcttttggcggcaacatcgcatggccgtctaa

DBGET integrated database retrieval system