KEGG   Lactobacillus casei W56: BN194_03300Help
Entry
BN194_03300       CDS       T02337                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lcw  Lactobacillus casei W56
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN194_03300 (rbsK)
Enzymes [BR:lcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BN194_03300 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330651..331580
Genome map
AA seq 309 aa AA seqDB search
MPNHVVVIGSINVDSILHIQRLPQPGETIKMDTFSQAAGGKGANQAVAAARSGAKTSFIG
RVGDDANAAFMRGELVKNQIDTQYVATTVGTQTGQAYILLQASGQNSIIIQHGANFEVTP
ADVQRAADLIQSADFVVAEFETPVDATAEAFKIAKAAGKMTILNPAPAQKDLPAALLKNV
DLIAPNETESELITGIPVVDEDSMRASAAYYHELGIRGVIITLGSKGSFISLDGEATIVP
AFKVKAVDTTAAGDTFIGALASVLQTDLKNIVTAASYASMASSFTVQKLGAFPSIPMGDE
VRAALAKIK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcatgttgttgtcatcggcagtatcaatgtcgatagcatcttgcacattcaa
cggttgccacaaccgggagaaacgatcaaaatggacaccttttcgcaagcggctggcggt
aaaggggcgaatcaagcagttgcggctgcgcgttcgggggccaaaaccagttttattggc
cgagtcggtgacgatgccaacgctgccttcatgcgcggtgaacttgtcaagaaccaaatc
gacacccaatatgtggcgacaacggttggcacgcaaaccggtcaggcttacattttgctg
caagcctctggtcaaaattccattatcatccagcatggcgctaattttgaggtgacacca
gcagatgtgcaacgagcagccgacttgattcagtctgccgactttgtggtcgcggaattt
gaaacaccggtggatgcgacggcagaggccttcaaaattgccaaagctgctgggaagatg
accatcttaaacccagcgccggcacagaaggatttgccagcagccttgctgaaaaatgtg
gatctcatcgcaccgaacgaaaccgaaagcgagctgatcaccggcattccggtggtagat
gaagacagcatgcgggcttcggcagcttattatcatgaattaggtattcgcggtgtgatc
atcactttaggatcaaaaggctccttcatctcgctggatggcgaagcaaccatcgtgcca
gcctttaaagtcaaggctgtcgacaccaccgccgcgggcgacacgttcattggtgccttg
gcaagcgtcttgcagacagatcttaagaacattgtcacggcggcgagctatgccagcatg
gcaagttctttcacggttcagaaacttggcgccttcccgtccattccgatgggggatgag
gtgcgggcggcgttagcgaaaatcaagtga

DBGET integrated database retrieval system