KEGG   Lactobacillus casei W56: BN194_05200Help
Entry
BN194_05200       CDS       T02337                                 

Gene name
bglH
Definition
aryl-phospho-beta-D-glucosidase BglH (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lcw  Lactobacillus casei W56
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lcw00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(510295..511725)
Genome map
AA seq 476 aa AA seqDB search
MKQRFPENFLWGASTSAYQVEGAAITHGKGLSQQDFINNNRSEKFGFADTSIASDHYHHF
KEDIRLFKEMGFTSYRFSIAWSRIFPKGDHQVNEEGLQFYRDLIAELKANDIEPIPTLYH
YDLPWALVEKYEGWLSREVVEDFGYFAKFVVNEFKNDVKYWITINEQSIIVQYWTQKCYV
PEKYQNQNQLRYQINHHMNLAQALAVKYIHEVGGLAGPALGYAPVYARTCKPEDQLAALN
ANDLRNFYYLDVYFKGYYTDAAFNYLKQHQLAPEIFDDDETLFSQNISDFLAVNYYDSQC
AHACPEGADHAWSGYNLTGKKGDMSGFETHPGFYQMCPNPELRTTDWDWAIDPIGLEIVY
RDLYTRYRIPFMITENGLGARDELTSDGKVHDDYRIAYLREHIAATQRAMGLGVQVLGYM
PWSALDLLSTSNGYNKRYGLIYVDRTDDDPKTCQRIKKDSFNWYKKVIASNGTDLS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgttttccagagaatttcctttggggtgcttcaacaagtgcctaccaagtc
gaaggtgccgcgatcacccacggcaagggcctttcgcaacaagattttattaacaataac
cgatctgaaaagtttggctttgccgatacaagcatcgctagtgaccactatcaccacttc
aaagaagatatccgcttatttaaagaaatgggttttactagctatcgtttttcaattgct
tggtcgcggatttttccaaaaggcgatcatcaggttaacgaagaaggtttacaattttat
cgcgatttgattgctgaactcaaagcaaacgatatcgagcccatccctactttgtatcat
tacgacctgccttgggctttggttgaaaaatatgaaggctggttatctcgcgaggttgtc
gaagactttggctattttgccaagtttgtggtcaatgagttcaaaaatgatgtgaagtac
tggatcacaatcaatgaacagagcatcatcgtccaatattggacccagaagtgttatgta
cccgaaaagtatcaaaatcaaaaccaattgcgttatcagatcaatcatcatatgaacctc
gcccaggcattagccgtgaaatatatccacgaggtcggtggtttggcaggcccagcatta
ggctatgcgccagtttacgctcgcacctgcaagcctgaggatcagctggcggccttgaat
gccaacgacctccgaaatttctattatcttgacgtgtattttaaaggttattacaccgat
gctgccttcaattatttgaagcaacatcagttggcacccgaaatctttgacgacgatgaa
accctcttttcacaaaacatctccgattttcttgctgtcaactattatgacagtcagtgc
gctcacgcttgtcctgaaggtgctgatcatgcttggtcagggtataacttaactggcaaa
aaaggtgacatgtcaggatttgaaacgcatcctggtttttaccaaatgtgtcctaatccc
gaactgcggacaactgattgggactgggccattgatcccattgggttggagattgtctat
cgcgatctttatactcgctaccgcatcccgttcatgattaccgaaaacgggctaggtgca
cgcgatgagctcacaagtgatggcaaagtgcatgatgactatcggattgcttacttacgc
gagcatattgccgccacgcaacgcgccatgggtctcggtgtgcaggttttaggctacatg
ccatggtcggctttagatttgctttctacaagcaatggctacaacaaacgttacggcttg
atttatgttgatcgaaccgatgacgatcctaagacatgccagcgcattaagaaagattcc
ttcaactggtacaaaaaagtaatcgcctcaaatggtactgatctcagttga

DBGET integrated database retrieval system