KEGG   Lactobacillus casei W56: BN194_08350Help
Entry
BN194_08350       CDS       T02337                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lcw  Lactobacillus casei W56
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lcw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
823916..824512
Genome map
AA seq 198 aa AA seqDB search
MYEYFEGIIQAVTPAYIVIDVHGIGFRLLVANPYHFEAGEQKRVYVQLIIRDNDQTLYGF
EGAADKRTFNQLLTVTGIGPKSALAILANVSSGGLATAIAQDDVKFLTKFPGIGKKTAAQ
IILDLKGKITTDGQPAAAAIAPVASDVDSELADALAALVALGYPQRTVDGLTDTLKAFSA
KTTDAYLREGLRLLSGKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtattttgaaggcattattcaggcggtgaccccggcttacatcgtcatcgat
gtgcatggcatcgggttccgtctgctggtagccaacccttatcattttgaagctggcgag
caaaaacgtgtttatgtgcagctgatcattcgcgacaacgaccagacactttatggattc
gaaggtgctgcggataagcgtacctttaaccagctattgacggtcacaggcattggcccg
aagtcagcgttggccattttggcgaacgtgtctagcggcggcttggcgactgcgattgct
caagatgatgtgaagtttttgactaagtttcctgggatcggtaagaaaacagctgcccag
attatccttgatctcaaaggtaaaatcacaacagatggacaaccagcggcagcagcgatt
gcaccagttgccagtgacgttgattcggaacttgcagatgcgttagcggcactcgtggca
ttgggctacccgcaacgcaccgttgatggtctcactgacacactgaaggcattcagtgcc
aagacaactgatgcctatttacgcgaaggcttgcggctattaagcggcaaggcttag

DBGET integrated database retrieval system