KEGG   Lactobacillus casei W56: BN194_08400Help
Entry
BN194_08400       CDS       T02337                                 

Gene name
ADH2
Definition
aldehyde-alcohol dehydrogenase 2 (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lcw  Lactobacillus casei W56
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BN194_08400 (ADH2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN194_08400 (ADH2)
   00620 Pyruvate metabolism
    BN194_08400 (ADH2)
   00650 Butanoate metabolism
    BN194_08400 (ADH2)
  Lipid metabolism
   00071 Fatty acid degradation
    BN194_08400 (ADH2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BN194_08400 (ADH2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN194_08400 (ADH2)
   00626 Naphthalene degradation
    BN194_08400 (ADH2)
Enzymes [BR:lcw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN194_08400 (ADH2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BN194_08400 (ADH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829415..832021
Genome map
AA seq 868 aa AA seqDB search
MLKNTAKTATEVDVKSMVDELVANAHAALKIMKTFDQEKIDHIVHRMAIAGLDHHMELAK
LAVDETGRGVWEDKAIKNMFATEEIWHSIKNNKTVGVINEDKQRGLVSIAEPIGVIAGVT
PVTNPTSTTMFKSEIAIKTRNPIIFAFHPGAQKSSARALEVIRDEAEKAGLPKGALQYIP
VPSMDATKALMDHPGIATILATGGPGMVKSAYSSGKPALGVGAGNAPAYIEASANIKQAV
NDLVLSKSFDNGMICASEQGVIIDSSIYDDVKKEFEAQGAYFVKQKDMKKFESTVINLEK
QSVNPRIVGQSPKQIAEWAGITIPDNTTILIAELKGVGEKYPLSREKLSPVLAMVKADGH
EDAFKKCETMLDIGGLGHTAVIHTADDELALKYADAMQACRILINTPSSVGGIGDLYNEM
IPSLTLGCGSYGGNSISHNVGTVDLLNIKTMAKRRNNMQWMKLPPKIYFEKNSVRYLEHM
EGIKRAFIVADRSMEKLGFVKIVEDVLARRENPVQVQTFVDVEPDPSTDTVFKGTDIMRS
FGPDTVIAIGGGSVMDAAKGMCLFNDAGDADFFGAKQKFLDIRKRTYTFPNLNKTKLVCI
PTTSGTGSEVTPFAVITDSKAGIKYPLADYALTPDIAIVDSQFIESVPPVVVADSGLDVL
CHATESYVSTMATHYTKGLSLEAIKLVFENLEKSYHGDVEAKSKMHDASTIAGMAFANAL
LGINHSIAHKIGQAFHLPHGRCIAITMPHVIRFNASQPKKRAIWAKYSYFRANEDYAEIA
RYLGLPGKTTDELVESYVQAFIKLAHSVGVKLSLKEQGVKKADLDKQVDRLAELAYEDNC
TVTNPQEPLIGDLKHIILDEYEGTESTF
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagaatactgcgaagactgctaccgaagttgatgtaaagagcatggttgacgaa
ctggttgcgaatgcgcatgccgctttgaagatcatgaaaacttttgatcaagaaaagatc
gatcacatcgttcatcggatggcaatcgctggtttggatcatcatatggaattggcaaaa
ctcgctgttgacgagacgggccgtggcgtgtgggaagataaagcgatcaagaacatgttc
gccaccgaagaaatttggcactcaatcaagaacaacaagaccgttggtgtgatcaacgaa
gacaaacaacgcggcttggtatcgattgctgaaccaattggtgtcattgctggtgtgacg
ccagtgacgaacccaacttcaacgaccatgttcaaatccgaaattgccattaaaacccgt
aatccaatcattttcgccttccatccgggtgcccaaaagtcttcagcgcgtgcgttggag
gtcatccgtgatgaagccgaaaaagcaggcttaccaaagggtgctttgcaatatatccct
gtaccaagtatggatgcgactaaagctttgatggatcaccctggtatcgccacgattttg
gcaacgggcggtcctggcatggttaagtccgcctattcatcaggcaagccagcactgggt
gttggggccgggaatgcgccagcttacattgaagccagcgctaacatcaaacaagctgtc
aatgacttagtactttcaaagagttttgataatggcatgatctgtgcttccgaacaaggc
gtgattattgattccagcatttacgatgatgtgaagaaggaatttgaagcccaaggtgct
tatttcgttaaacagaaggacatgaagaagttcgagagtaccgtcattaatcttgaaaag
caaagtgtcaatccgcgaatcgttggtcaaagtcctaagcagattgctgaatgggcgggg
atcacgattcctgataacaccacgattctgattgctgaattgaaaggtgttggcgaaaag
tatccactgtctcgtgaaaaattaagtccagtactggccatggtcaaagcagatggtcac
gaagatgccttcaagaaatgtgaaaccatgcttgatatcggcggtttgggtcatacggca
gtcattcacacggctgatgatgagttagctttgaagtatgccgatgctatgcaagcttgc
cggattttgatcaacacaccatcttctgtcggcgggattggcgatctttacaacgaaatg
attccaagtttgacactgggctgcggctcatacggtggtaactcaatttcgcataacgtg
gggacggtcgacttgcttaacatcaagacaatggcaaaacgccgcaataacatgcagtgg
atgaaattgccaccaaagatctattttgaaaagaattctgttcgttacctcgaacacatg
gaaggcatcaaacgggccttcatcgttgctgatcgaagcatggaaaagttaggcttcgtc
aagatcgttgaagatgttctggctcggcgtgaaaatcctgttcaagttcagacttttgtc
gatgttgaacctgatccatcaactgacacggtcttcaaggggaccgatatcatgcgctca
tttggaccggataccgtcattgctatcggcggcgggtctgttatggatgctgccaaaggg
atgtgcttgttcaacgatgccggggatgctgatttcttcggcgctaagcagaaattcttg
gatattcggaagcggacttacaccttcccgaatctgaataagacaaagcttgtctgcatt
ccaacaacttctgggactggttcagaagtaacaccttttgcggttatcaccgattccaag
gctggcatcaagtatccgttagctgactatgcattgacgccagacatcgcgattgtggac
agtcagttcatcgaatccgtaccgccagtggttgtcgctgattccggtttggatgtgctc
tgccacgcaaccgaaagttatgtttcaaccatggctactcattacacgaagggcctgagt
ctggaagcaatcaagttggtcttcgaaaatctggaaaagagttatcatggcgacgtcgaa
gcaaagtcaaagatgcatgacgcttcaaccattgccgggatggcctttgccaacgcactg
ttgggtattaaccacagcatcgcccataagatcgggcaagcgttccatctgcctcacggt
cgttgcatcgcgatcacgatgccgcatgttatccgcttcaatgcgagtcaaccgaagaag
cgcgctatctgggcgaagtatagctacttccgcgctaacgaagactacgcagaaatcgct
cgctacctcggccttcctggcaagacaactgatgaattggttgaaagctatgtccaggcc
ttcatcaagctggctcacagtgttggcgtcaagctcagtttgaaggaacaaggcgttaaa
aaggctgatctcgacaagcaagttgatcgtcttgccgaactggcttatgaagacaactgc
accgttaccaacccgcaagaaccgttaatcggcgacttgaagcatatcatccttgatgaa
tatgaaggcaccgaatccactttctaa

DBGET integrated database retrieval system