KEGG   Lactobacillus casei W56: BN194_11750Help
Entry
BN194_11750       CDS       T02337                                 

Gene name
agaR
Definition
alpha-galactosidase 1 (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lcw  Lactobacillus casei W56
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lcw00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lcw00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155430..1157721
Genome map
AA seq 763 aa AA seqDB search
MIDVINNQAFHLHNDQISYICALLPNGQLGHLYFGPRLSLTKNDLAYLSQGPSPFAWMAN
FSDDQEFALGDAQQEYPVYGTGDFRQGSLSVTQDDMPIYPNFVFKDDQLTHTKTRDLHHP
TSFGNPALTDVLTIHLEDKTAQLLLTLQYTIFADSAAIVRSATLTNQGTAPVMIQRMLSG
VLNLPQGRYDVVHLSGNWAKERHIQTQPLTQGTFSVESLRGASSHEQNPFVALHAAGQPF
AAGDTYGANLIYSGNFLDSTEVNEWDQTRLLTGIHPASFSWRLDPKTSFTTPETVFSYSS
GGLAGLAQANQRFVARHIIDPQWRQKQRPVVLNSWEATYFDLNEKKLLKLAALGKQVGVD
CFVLDDGWFGTRDNDLSSLGDWFTNKHKFPDGLGHFAQEIHAMGLQLGLWFEPEMVSPRS
QFFQAHPNWVVRPKKGRISITCNQYVLDFSNPAVVNNIFEQMQKVITETNLDYVKWDLNR
SITEAFSPYLEKIGHPQGEFFHRYVQGVYTLYQKLLTAFPHLLIEGCAGGGGRFDLGILF
YSPQIWTSDDSDAIERLAIQSGTALAYPLSCMSNHVTAVPNEQVGRSTPLVTRFRVAAFG
ILGYELDLTKLDARTLATIKAQIAYYHALQPLVLKGDFSLLLPRQSNGQNQVAWLLSAHD
RKHLVLGFFRVLADADSRTVQYMKVPLAKSDTPYWVNQHTGPISGDVLQRVGVRLPVQFN
GANRAQAQLIGDYQSALLTFDSVASLDHSESQQTDADKQTVAH
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
ttgatagatgttataaataatcaagcttttcatcttcacaacgatcaaatcagttatatt
tgcgctttgctgccgaatggtcagctcgggcatctttattttggtccgcgcttgtcatta
actaaaaacgacttagcctatttgtctcaaggcccaagtccgtttgcgtggatggccaat
ttttcagacgaccaggaatttgccttgggtgatgcgcagcaagagtatcctgtttacggc
actggtgattttcgccaaggcagcctgagtgtgacccaagatgatatgccaatttatccg
aactttgtttttaaagatgatcaattgacgcatacgaaaacgcgggacttgcaccatccg
acgagtttcggcaatccggcattgaccgatgtgctgacgattcatcttgaagataaaacg
gcccaattgttgctaacgttgcaatatacgatttttgccgacagtgcggcaattgttcgt
tccgccacactaaccaatcaagggacagcaccagtgatgattcaacgcatgctgagtggc
gttttgaacttgccgcaaggacggtatgacgttgttcatttatctggtaattgggcgaag
gagcgtcatattcaaacgcaaccgttaacccagggaactttttcagttgaatcgctacgt
ggtgcctccagtcatgaacaaaatccttttgtggccttacatgcagcgggacagccgttt
gcagcaggggatacctatggggcgaacttgatttattcgggcaactttctggacagcacc
gaggtcaacgaatgggatcagactcgattgctaactggcattcatcccgcatcgtttagt
tggcggttggatccaaaaaccagttttaccacgccagaaaccgtgtttagttatagctct
ggtggtcttgccggcttagctcaggccaatcaacgttttgttgctcgccatattattgat
ccgcaatggcgtcaaaagcagcgtccggtcgtcttaaacagctgggaagcgacttacttt
gatttgaatgagaagaagttgctcaagctagcggcactcggcaagcaggtcggtgtggac
tgctttgtgctggatgatggttggtttgggacgcgcgacaatgatttgagttccttgggt
gattggtttactaataagcataaatttcccgacggtctcggccattttgctcaggaaatt
catgcgatgggcctgcagcttggcctttggtttgaacccgagatggtttcaccgcgatct
caattcttccaagcccatccgaattgggtcgttcgaccaaaaaagggtcgtatctcgatc
acgtgtaatcaatatgtgttagacttcagcaacccggctgtcgtcaacaatatttttgaa
cagatgcaaaaggtcatcactgaaaccaacttggattatgtgaagtgggatcttaatcgc
agcattacagaggccttttcaccgtatctcgaaaagatcggtcatccgcaaggcgagttc
ttccatcgttatgtacaaggcgtgtacacgctctatcagaagctgctaacagcattcccg
catttattgattgaagggtgtgccggcggtggtggccgctttgatctgggcattctgttc
tacagcccgcaaatttggactagtgatgattccgatgcgatcgaacgcctcgccattcaa
tcaggcacggctttggcctatccattgagctgtatgagcaatcatgtgacggccgtgccg
aatgaacaggttggtcgatcaacgccgctggtcacgcggtttcgggtggcggcctttggg
attcttggttatgaactggatctgaccaaacttgatgcgcgaacattggctacgatcaag
gctcaaattgcctattaccacgccttacaaccgctagtactgaaaggcgactttagccta
ttgttaccgcgacagtccaatgggcagaatcaggtggcgtggttgctcagcgctcatgat
cgcaagcaccttgttcttggctttttccgagtcttggctgatgcagacagtcgcaccgtg
cagtatatgaaggtgccattggcaaaatctgacacaccgtattgggtcaatcagcacaca
ggcccaatttcgggggatgtcctccagcgcgttggtgtgcgcttaccagtccaattcaat
ggcgccaatcgcgcacaggctcagttaatcggtgactatcaatcggcactgttgaccttt
gatagtgtggcaagtttggatcacagtgaaagccagcagaccgatgccgacaagcaaaca
gttgcccattaa

DBGET integrated database retrieval system