KEGG   Lactobacillus casei W56: BN194_11750Help
Entry
BN194_11750       CDS       T02337                                 

Gene name
agaR
Definition
(GenBank) Alpha-galactosidase 1
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
lcw  Lactobacillus casei W56
Pathway
lcw00052  Galactose metabolism
lcw00561  Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BN194_11750 (agaR)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BN194_11750 (agaR)
   00600 Sphingolipid metabolism
    BN194_11750 (agaR)
Enzymes [BR:lcw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BN194_11750 (agaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2 DRE2_N
Motif
Other DBs
NCBI-ProteinID: CCK22122
UniProt: K0N413
Position
1155430..1157721
Genome map
AA seq 763 aa AA seqDB search
MIDVINNQAFHLHNDQISYICALLPNGQLGHLYFGPRLSLTKNDLAYLSQGPSPFAWMAN
FSDDQEFALGDAQQEYPVYGTGDFRQGSLSVTQDDMPIYPNFVFKDDQLTHTKTRDLHHP
TSFGNPALTDVLTIHLEDKTAQLLLTLQYTIFADSAAIVRSATLTNQGTAPVMIQRMLSG
VLNLPQGRYDVVHLSGNWAKERHIQTQPLTQGTFSVESLRGASSHEQNPFVALHAAGQPF
AAGDTYGANLIYSGNFLDSTEVNEWDQTRLLTGIHPASFSWRLDPKTSFTTPETVFSYSS
GGLAGLAQANQRFVARHIIDPQWRQKQRPVVLNSWEATYFDLNEKKLLKLAALGKQVGVD
CFVLDDGWFGTRDNDLSSLGDWFTNKHKFPDGLGHFAQEIHAMGLQLGLWFEPEMVSPRS
QFFQAHPNWVVRPKKGRISITCNQYVLDFSNPAVVNNIFEQMQKVITETNLDYVKWDLNR
SITEAFSPYLEKIGHPQGEFFHRYVQGVYTLYQKLLTAFPHLLIEGCAGGGGRFDLGILF
YSPQIWTSDDSDAIERLAIQSGTALAYPLSCMSNHVTAVPNEQVGRSTPLVTRFRVAAFG
ILGYELDLTKLDARTLATIKAQIAYYHALQPLVLKGDFSLLLPRQSNGQNQVAWLLSAHD
RKHLVLGFFRVLADADSRTVQYMKVPLAKSDTPYWVNQHTGPISGDVLQRVGVRLPVQFN
GANRAQAQLIGDYQSALLTFDSVASLDHSESQQTDADKQTVAH
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
ttgatagatgttataaataatcaagcttttcatcttcacaacgatcaaatcagttatatt
tgcgctttgctgccgaatggtcagctcgggcatctttattttggtccgcgcttgtcatta
actaaaaacgacttagcctatttgtctcaaggcccaagtccgtttgcgtggatggccaat
ttttcagacgaccaggaatttgccttgggtgatgcgcagcaagagtatcctgtttacggc
actggtgattttcgccaaggcagcctgagtgtgacccaagatgatatgccaatttatccg
aactttgtttttaaagatgatcaattgacgcatacgaaaacgcgggacttgcaccatccg
acgagtttcggcaatccggcattgaccgatgtgctgacgattcatcttgaagataaaacg
gcccaattgttgctaacgttgcaatatacgatttttgccgacagtgcggcaattgttcgt
tccgccacactaaccaatcaagggacagcaccagtgatgattcaacgcatgctgagtggc
gttttgaacttgccgcaaggacggtatgacgttgttcatttatctggtaattgggcgaag
gagcgtcatattcaaacgcaaccgttaacccagggaactttttcagttgaatcgctacgt
ggtgcctccagtcatgaacaaaatccttttgtggccttacatgcagcgggacagccgttt
gcagcaggggatacctatggggcgaacttgatttattcgggcaactttctggacagcacc
gaggtcaacgaatgggatcagactcgattgctaactggcattcatcccgcatcgtttagt
tggcggttggatccaaaaaccagttttaccacgccagaaaccgtgtttagttatagctct
ggtggtcttgccggcttagctcaggccaatcaacgttttgttgctcgccatattattgat
ccgcaatggcgtcaaaagcagcgtccggtcgtcttaaacagctgggaagcgacttacttt
gatttgaatgagaagaagttgctcaagctagcggcactcggcaagcaggtcggtgtggac
tgctttgtgctggatgatggttggtttgggacgcgcgacaatgatttgagttccttgggt
gattggtttactaataagcataaatttcccgacggtctcggccattttgctcaggaaatt
catgcgatgggcctgcagcttggcctttggtttgaacccgagatggtttcaccgcgatct
caattcttccaagcccatccgaattgggtcgttcgaccaaaaaagggtcgtatctcgatc
acgtgtaatcaatatgtgttagacttcagcaacccggctgtcgtcaacaatatttttgaa
cagatgcaaaaggtcatcactgaaaccaacttggattatgtgaagtgggatcttaatcgc
agcattacagaggccttttcaccgtatctcgaaaagatcggtcatccgcaaggcgagttc
ttccatcgttatgtacaaggcgtgtacacgctctatcagaagctgctaacagcattcccg
catttattgattgaagggtgtgccggcggtggtggccgctttgatctgggcattctgttc
tacagcccgcaaatttggactagtgatgattccgatgcgatcgaacgcctcgccattcaa
tcaggcacggctttggcctatccattgagctgtatgagcaatcatgtgacggccgtgccg
aatgaacaggttggtcgatcaacgccgctggtcacgcggtttcgggtggcggcctttggg
attcttggttatgaactggatctgaccaaacttgatgcgcgaacattggctacgatcaag
gctcaaattgcctattaccacgccttacaaccgctagtactgaaaggcgactttagccta
ttgttaccgcgacagtccaatgggcagaatcaggtggcgtggttgctcagcgctcatgat
cgcaagcaccttgttcttggctttttccgagtcttggctgatgcagacagtcgcaccgtg
cagtatatgaaggtgccattggcaaaatctgacacaccgtattgggtcaatcagcacaca
ggcccaatttcgggggatgtcctccagcgcgttggtgtgcgcttaccagtccaattcaat
ggcgccaatcgcgcacaggctcagttaatcggtgactatcaatcggcactgttgaccttt
gatagtgtggcaagtttggatcacagtgaaagccagcagaccgatgccgacaagcaaaca
gttgcccattaa

DBGET integrated database retrieval system