KEGG   Lactobacillus casei W56: BN194_11900Help
Entry
BN194_11900       CDS       T02337                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lcw  Lactobacillus casei W56
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BN194_11900
Enzymes [BR:lcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BN194_11900
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BN194_11900
Lipid biosynthesis proteins [BR:lcw01004]
 Fatty acid synthase
  Component type
   BN194_11900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1167403..1168194)
Genome map
AA seq 263 aa AA seqDB search
MKKFWLGFGLLLLILAAGCEVQHKAAKSSSSAASLRSRKSPSSRSSAAIKQTSMLARLKA
KSQTTLVYAPFGDSLSVGLFADSKTSRFTTLFADQLHHLTDKTVTEEGIAEVGKTATNLG
VPALPALIAQHPDLITIEFGTNDAVGGATPTALADYRQALTTIVATLQKQTTAELILMTT
WSPNHGPYAAADLQFDAVVKQIGQTYHVPVADLATIWQNHDDVTGPAGTAITDFAGNGPR
DTFHPNQRGHDQIAALLKKTLEE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttttggttgggttttggtcttttattgctcattttagcggctggctgcgag
gttcaacacaaggcggctaaatcgagcagttcagcggcttcgcttcgcagccgcaagtcg
cctagttcgcgatcctcagctgcgattaagcagacaagcatgctcgcccggctgaaggca
aaatcacaaacgacgctcgtgtatgcaccgtttggcgacagcctctctgttggtttgttt
gcggatagtaaaacaagccggtttaccaccctttttgctgaccaattacaccatttgact
gacaagacggtgacagaggaagggattgcagaggtgggaaaaaccgcgactaatcttggt
gtccctgctctgccagcgttgattgcccagcatcctgatttgattaccatcgagtttggg
acgaacgatgcggttggcggcgccacaccaacggcgctggctgattaccgccaggcgttg
acaaccatcgtggcaaccttgcagaagcaaacaacagctgagttgatccttatgacgacc
tggtcgccaaaccatggtccttatgccgccgccgatttgcaatttgatgctgtggtcaaa
caaatcggtcaaacttatcacgttccagttgccgatctggcgaccatctggcaaaaccat
gatgacgtcacaggccctgccggtacagccatcaccgacttcgctggtaacggtccgcgc
gatacttttcaccccaaccagcgcggtcatgatcagattgctgccttgctcaagaaaact
ttggaggaataa

DBGET integrated database retrieval system