KEGG   Lactobacillus casei W56: BN194_13490Help
Entry
BN194_13490       CDS       T02337                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lcw  Lactobacillus casei W56
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BN194_13490
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN194_13490
Enzymes [BR:lcw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BN194_13490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1311969..1312922)
Genome map
AA seq 317 aa AA seqDB search
MAFSAKASLATAIGRSSYWFLHTFLKGGSSLPGQIANRIDPQVLRTLGQNYDVIVVTGTN
GKTLTTSLIVKVLKKKYKEVLTNPTGSNMLQGITTAFLAQPKRGHGRGIAVLEVDEANVA
PVAAQLKPKAFVLTNIFRDQMDRYGEFYTTYQKILDGVTRDPEAMVIANGDAPIFSSRKL
PNPVTYYGFELTANGDHKAPPNTDGVLCPVCQHILHYHAQTYANLGNYFCPHCGFKRPAL
THQITEVTQMTPQSSDFMIDDQPCHIDIGGMYNIYNALAAFAVGRAFGVTPTEISQAFAY
DEKVFGRQEVIQLGKKN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggcattttctgcaaaagctagcctggcaactgccattggtcgcagcagttactggttc
ttacacacatttctaaaaggcgggtcgagcctaccaggccagatcgccaaccgaattgat
ccccaagtcttgcggacgctcggtcaaaactacgatgttattgtggtgactggaacaaat
ggcaagacgttgaccaccagcctgattgttaaggtgcttaagaaaaaatataaagaagtc
ttaacgaaccccactggctccaacatgttgcaaggtatcacaacggcttttttggcccag
ccgaagcgcggtcatggccgcggtatcgctgtgctcgaagtcgatgaggccaatgttgca
ccagttgccgctcagttaaaacccaaggcctttgttctcaccaatattttccgcgaccag
atggaccgttatggggaattttataccacctatcagaaaattttagacggtgtgacacgc
gatcctgaagcgatggtcattgctaatggcgacgctccgattttcagctcccgaaagctg
cctaatccagtcacctactacggctttgaactcacggcaaatggcgatcataaagccccg
ccgaatacggacggtgtcttatgtccggtatgtcagcacattctgcactaccatgcacaa
acttacgccaatttgggcaattatttttgtccgcattgcggcttcaaacgccccgcttta
acccatcaaatcaccgaggtcacccaaatgaccccacaaagcagcgacttcatgattgat
gatcaaccatgccacatcgacatcggtggcatgtataacatctacaacgcgctcgccgcc
tttgctgttggccgggcgttcggtgttaccccgactgaaatcagccaagcttttgcttat
gacgagaaggtcttcggtcgtcaagaagtcattcaacttggcaagaaaaattaa

DBGET integrated database retrieval system