KEGG   Lactobacillus casei W56: BN194_13490Help
Entry
BN194_13490       CDS       T02337                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lcw  Lactobacillus casei W56
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lcw00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lcw00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1311969..1312922)
Genome map
AA seq 317 aa AA seqDB search
MAFSAKASLATAIGRSSYWFLHTFLKGGSSLPGQIANRIDPQVLRTLGQNYDVIVVTGTN
GKTLTTSLIVKVLKKKYKEVLTNPTGSNMLQGITTAFLAQPKRGHGRGIAVLEVDEANVA
PVAAQLKPKAFVLTNIFRDQMDRYGEFYTTYQKILDGVTRDPEAMVIANGDAPIFSSRKL
PNPVTYYGFELTANGDHKAPPNTDGVLCPVCQHILHYHAQTYANLGNYFCPHCGFKRPAL
THQITEVTQMTPQSSDFMIDDQPCHIDIGGMYNIYNALAAFAVGRAFGVTPTEISQAFAY
DEKVFGRQEVIQLGKKN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggcattttctgcaaaagctagcctggcaactgccattggtcgcagcagttactggttc
ttacacacatttctaaaaggcgggtcgagcctaccaggccagatcgccaaccgaattgat
ccccaagtcttgcggacgctcggtcaaaactacgatgttattgtggtgactggaacaaat
ggcaagacgttgaccaccagcctgattgttaaggtgcttaagaaaaaatataaagaagtc
ttaacgaaccccactggctccaacatgttgcaaggtatcacaacggcttttttggcccag
ccgaagcgcggtcatggccgcggtatcgctgtgctcgaagtcgatgaggccaatgttgca
ccagttgccgctcagttaaaacccaaggcctttgttctcaccaatattttccgcgaccag
atggaccgttatggggaattttataccacctatcagaaaattttagacggtgtgacacgc
gatcctgaagcgatggtcattgctaatggcgacgctccgattttcagctcccgaaagctg
cctaatccagtcacctactacggctttgaactcacggcaaatggcgatcataaagccccg
ccgaatacggacggtgtcttatgtccggtatgtcagcacattctgcactaccatgcacaa
acttacgccaatttgggcaattatttttgtccgcattgcggcttcaaacgccccgcttta
acccatcaaatcaccgaggtcacccaaatgaccccacaaagcagcgacttcatgattgat
gatcaaccatgccacatcgacatcggtggcatgtataacatctacaacgcgctcgccgcc
tttgctgttggccgggcgttcggtgttaccccgactgaaatcagccaagcttttgcttat
gacgagaaggtcttcggtcgtcaagaagtcattcaacttggcaagaaaaattaa

DBGET integrated database retrieval system