KEGG   Lactobacillus casei W56: BN194_13500Help
Entry
BN194_13500       CDS       T02337                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lcw  Lactobacillus casei W56
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lcw00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1313050..1313640
Genome map
AA seq 196 aa AA seqDB search
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKRVILMTSAVDDRAGVGMIASRIGLERTAI
PITHETNLYDIIKATDPKAACVLIDEAQFLQKHHIFEAARVVDELHIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCAKKAIMNLRIHDGQPVYEGKQVLIGGNESYYPVC
RHHYFHPPLKQIDPTD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcttttctttcgttacggtgcgatgaactccgggaaaagtattgaaatcctg
aaggttgcgcataactatgaagaacaaaataagcgcgtaattttgatgacaagtgccgtg
gatgatcgtgccggcgtcggtatgattgccagtcgaatcggcttagaacgcacggcaatt
ccgattacacacgaaaccaacctttacgacatcatcaaggcaactgatcctaaggctgcc
tgtgtgttgatcgatgaggcgcagttcctgcagaaacatcacatttttgaagcagcacgt
gtggttgatgaattacatattccagtcatggcgttcggtttgaaaaatgatttccgcaat
gagctgtttgaaggttcaaaatatttattactctatgcggacaaaattgaagaaatgaaa
acgatctgctggttttgtgccaaaaaagcgattatgaatttacggattcatgatggccag
ccagtctacgaaggcaaacaagtactgattggtgggaatgagtcgtattatccagtttgc
cgacatcattattttcatccgccattgaagcagattgaccccaccgattaa

DBGET integrated database retrieval system