KEGG   Lactobacillus casei W56: BN194_14120Help
Entry
BN194_14120       CDS       T02337                                 

Gene name
gstA
Definition
glutathione S-transferase GstA (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lcw  Lactobacillus casei W56
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN194_14120 (gstA)
Enzymes [BR:lcw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN194_14120 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1367424..1368053
Genome map
AA seq 209 aa AA seqDB search
MLKLFYASGTSAMAPHILLTDAGLNFELEKVNLDQKTWRGGDYDQINAKSYVPTLQIAPE
QYLTECAVILEYIDFQARQNDGSNYATDEYWQERVWLNYIATELHKNFISPFRKGNWLPN
TDDSKRLVWQRVAPRLAYVEARFQGPWLMGQHFSMTNPYLFVMTNWMHRLDFSFDHLPKL
KAFDERMRQRPSVQEVLRVEGKPHSVTDG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaattattttatgcttcaggaaccagtgcaatggcgccgcatattctactgact
gacgcaggacttaattttgagttggaaaaggtgaacttagatcaaaaaacttggcgcggt
ggcgattacgatcaaatcaacgccaagtcttatgtgccgaccttgcaaatagcgccagaa
caatacttaacagaatgtgctgtgattttagagtacattgactttcaagcccgacaaaat
gatggtagcaattatgccacagatgaatactggcaggagcgggtgtggctcaactatatt
gccacagaactccacaaaaactttatttcgccttttcggaagggtaattggctacctaat
acggatgatagcaaacggttggtgtggcagcgagttgccccgcgactagcttatgttgaa
gcacggtttcagggaccatggctaatggggcagcatttttcaatgacgaatccttatctg
tttgtcatgacaaattggatgcaccggcttgatttttcatttgatcatttgccaaaatta
aaggcctttgacgagcgaatgcgacaacggccaagtgtgcaggaagttctgcgggtggaa
gggaagccgcacagcgttactgatggttaa

DBGET integrated database retrieval system