KEGG   Lactobacillus casei W56: BN194_18420Help
Entry
BN194_18420       CDS       T02337                                 

Gene name
glcK
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lcw  Lactobacillus casei W56
Pathway
lcw00010  Glycolysis / Gluconeogenesis
lcw00052  Galactose metabolism
lcw00500  Starch and sucrose metabolism
lcw00520  Amino sugar and nucleotide sugar metabolism
lcw00521  Streptomycin biosynthesis
lcw01100  Metabolic pathways
lcw01110  Biosynthesis of secondary metabolites
lcw01120  Microbial metabolism in diverse environments
lcw01130  Biosynthesis of antibiotics
lcw01200  Carbon metabolism
Module
lcw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN194_18420 (glcK)
   00052 Galactose metabolism
    BN194_18420 (glcK)
   00500 Starch and sucrose metabolism
    BN194_18420 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BN194_18420 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN194_18420 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BN194_18420 (glcK)
Enzymes [BR:lcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BN194_18420 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CCK22789
UniProt: K0NB57
Position
complement(1814730..1815737)
Genome map
AA seq 335 aa AA seqDB search
MMSCHCPPKNGGMTKMNDKKLIGVDLGGTTVKFAILTTDGEIQQRWSIDTNILDEGSHIL
PDIIDSINEHLKLYNMTPNDFVGIGMGSPGSVDIEAGTVIGAYNLNWKTLQQAKKDIEAG
TGIPFSIDNDANVAALGERWKGAGENDANVTFVTLGTGVGGGIIADGNLLHGVAGSAGEL
GHVTVDPVNGYLCTCGKRGCLETVASATGVVRVARDMAEEFAGDSKLKQTLDDGDEISSK
IVFDLAKTGDKLALMIVDRVSYFLGLALANVGNLLNPKFIVIGGGVSAAGDFLLKRVDKY
FKENTFPNVRETTSLRLATLGNTAGVIGAASLALK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atcatgagctgccattgcccgccgaaaaacggaggaatgacaaagatgaatgacaaaaaa
ttaattggtgtcgatctgggcggcacaacggttaaattcgcgatcttaaccactgatggt
gagattcaacagcgctggagcatcgatactaatattttggatgaaggcagtcacatcttg
ccggatatcattgattcgatcaacgaacatctcaaactctacaacatgacaccgaatgat
tttgtcggtatcggtatgggctcacctggttccgttgatattgaagcaggcacggtaatt
ggcgcttacaacttgaattggaaaaccttgcagcaggctaagaaggatattgaggctggt
actgggattccctttagtattgataacgacgccaatgttgctgccttgggcgaacgttgg
aaaggcgctggcgaaaatgacgccaatgtaactttcgtaacgcttggcacaggcgttggc
ggcggcattattgccgatggtaacttattgcatggtgttgcaggctcagcaggcgaactc
ggacacgtaactgttgatccggtcaatggttatctctgtacttgcggcaaacgcggttgt
ctcgaaactgtagccagtgcgactggcgttgtccgggtggcccgggatatggctgaagaa
ttcgctggcgactccaaactgaagcagacgttagatgatggcgatgagatttctagcaaa
attgtttttgatcttgccaaaaccggcgacaaacttgcgttgatgattgttgaccgggtt
agctactttcttggcttggcattggcaaatgtcggcaatctgctgaatccgaaattcatc
gtcattggtggcggcgtttcagcagcaggcgactttttgctgaagcgagttgataagtat
ttcaaggaaaatacgttcccgaatgttcgggaaacaacaagtctgcgtctggcaacgcta
ggtaacactgctggcgttatcggagctgccagccttgcacttaagtaa

DBGET integrated database retrieval system