KEGG   Lactobacillus casei W56: BN194_18920Help
Entry
BN194_18920       CDS       T02337                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lcw  Lactobacillus casei W56
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lcw03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1861333..1862232)
Genome map
AA seq 299 aa AA seqDB search
MKVIMDQLGSTLNKEISMPELPEVETVRRSLLPLVKNKVITAINTNWEKILINGLATFQK
EIVGSEITTIDRRGKYLLMRLSNGETIISHLRMEGRYYVVKDASTPFDKHDHVTFTFQDG
SQLRYRDLRKFGRMRLIKTGQEDQVPALAKLGPEPTPRTFDETEFARRLKRHHKPIKSVL
LDQTVVAGVGNIYADEVLWLSRLNPLQPADTLKSKEIKTLHDAIIQELNAAIAAGGTSAH
TYVDAEGNRGSFQNALHVYDREGTPCDRCGTTIVKIKVGQRGTHYCPHCQPLHQRRRPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtcattatggaccaacttggttcgacgctaaataaggagatttcaatgcctgaa
ttacctgaagtggaaacagttcgccgctcgcttctgccgttagtcaaaaataaagtcatt
accgccatcaacactaactgggagaaaatcctgatcaatgggttggcgacttttcaaaag
gaaattgtcggcagtgagatcacgaccattgatcggcgcggcaagtatcttttgatgcgc
ctcagcaatggtgaaacgattatcagccatctgcgtatggaagggcgttattatgttgtc
aaagatgcaagcacaccttttgataagcatgatcacgttacgttcacatttcaggatggt
agtcagttgcggtatcgggatctgcgaaagttcggtcggatgcgattgattaaaactggt
caggaagatcaggtgccagctcttgctaagctcggaccggaaccaacgccacgcacgttt
gacgagactgagtttgcccggcgcctgaaacgccatcataaaccgattaagtcggtttta
ctcgatcaaaccgtggtcgctggtgtgggcaatatttacgctgatgaggtactttggtta
agtcggctcaatccgctgcagccagctgacaccttgaaatctaaagaaatcaaaacactg
catgacgcgattatccaagaattaaatgcagccattgcggcaggcggcaccagcgcgcat
acgtatgttgatgcagaaggcaatcgcggttcttttcaaaatgccttgcacgtctatgat
cgggaaggtaccccgtgcgatcgctgcggcacgacgattgtcaaaattaaggttggtcag
cgcggaacccattactgcccgcactgtcagccattacatcaaaggaggcggccagcgtga

DBGET integrated database retrieval system